-] BBSBN "gvUL"ẻ ]-]*BBBABBBABB~>"!x>B@:"!x>Bh).@"!x>Bi).A"ax>BB1 "ax>B@1 $"ax>B- 1 "ax>B1 "ax>B1 ("ax>B1 8"ax>B1 H"ax>B1 \"ax>B1 "ax>B1 0"ax>B1 @"ax>B1 "ax>B1 P"ax>BF1 T"ax>BG1 X"ax>BC1 "ax>BI1 |"ax>BD1 ,"ax>BE1 <"ax>BF1 L"ax>BG1 `"ax>BH1 t"ax>BG1 d#ax>BC1  #ax>BH1 h#ax>BH1 l #ax>BB1   #ax>BH1 p#ax>BB1 #ax>BI1 x#ax>BD1 4#ax>BE1 D#ax>B%/#ax>B%/"#ax>B%/ %#ax>B%/ (#ax>B%/ +#ax>B%/ .#ax>B%/1#ax>B%/4#ax>B%/7#ax>B%/:#ax>B%/=#ax>B%/@#ax>B%/C#ax>B%/F#ax>B%/I#ax>B%/L#ax>B%/ O#!x>B). R#!x>B). U#!x>BF8:@X#!x>B@>:A[#!x>B).^#ax>B1a#ax>B1d#ax>B1g#ax>B1j#ax>B1m#ax>B1p#ax>B1s#ax>B1v#!x>Bվ).y#!x>B@:|#!x>B@:#!x>B@:#!x>B@:#!x>B` :#!x>B` :#!x>Be).#!x>B).#ABB/:#ax>B:d#ax>B:d#ax>B:d#ax>B:d#ax>B:d#ax>B:@d#ax>B:Ad#ax>B:Bd#ax>B:Cd#ax>B:Dd#!x>B~0 #!x>B~0# BBB/proc/kcore#!x>B). #ax>B1#ax>B1# BBB/proc/self/fd#BBBfd/1#BBBfd/0#BBBfd/2#BBBsocksys#BBBnull#!x>ف.0#!x>).#x>"1#!x>).#x>:#x>:#!x>?:#!x>4:#!x>4:#!x>4:#!x>?:#!x>4:#!x>4:#!x>4:$!x><%0 $BBBttyS0$BBBttyS0 $BBBttyS0$!t~>Bt~>B$!~>B~>C$ABBA $BBBash $4j~BB::8    $$)~BB:&'()*+,-./0)$T~BB::,123456789:;<=.$ P~BB!::,GHIJKLMNOPQRS3$h$~BB7]^_`abcdef8$Q~BB+::,ghijklmnopqrs=$m~BB8v}~B$<~BBE7G$"~BB::L$ ~BBY8Q$~BBm2:QRSTV$~BB::XUVWXYZ[\]^_`a[$~BB::``$\,~BB::e$a~BB;:4j$8~BB";:Fo$m8~BBl: t$~BB]7x    y$^~BB::2FGHIJKLMNOPQR~$~BB);:r_`abcdefghijk$\~BB5;: $K~BB;;:($6~BB(5:$hy~BB|;:@$~BB;:$Xm~BB;::$~BB;: $Lc~BBv;:4     $#~BB9: !"#$%&'$p~BBq:()*+,-.$ BBB/sbin/sulogin$m:~BB@9 /0123456789:;$P6~BB::?@ABCDEFGHIJK$BBBhostname$BBBhostname$~BB;: NOPQRS$|'~BB;:TUVWXYZ[\]$XH~BB;:(^_`abcdefghij$-~BB::rstuvwxyz{|}$D~BB4:~$,~BB ::$~BBl::$@~BB;:p$(~BBAr)*+,-./012345$ABBBb$@~BBBc%S~BB:d%<~BB@:e %~BB@9f%~BBwY>gh%~BB:i%~BB C:j %R~BBUY>k%%~BBT?l*%9BBBmn.%8~BB6:o3%BBBUTC7%t~BB ,=p;%G~BBY>%~2:%~5<zJ%ABB ?{N% ~BBY>|}~T%~BB ?Y%?~BB;KB^%G~BBN5<c%~BBc-=h%BBBrc.6l%D ~BB< ?p% ~BBD!<u%~BB:z%#~BBK:% ~BB@9%%~BB:%(~BB:%ABB6B:%=~BB8%P~BB\[>%~5<%~BB4j>%~BB M:%;~BB :%$~BB: %5~BB>,=%q~BBW:%BBS:%~BB:%A ~BBŘ:% ~BB5:%@~BB:%~BBV;%~BBV;%s~BBV;% ~BB?+?%w~BB?%ABB*q<%L*BBI:% BBBld-2.1.2.so& BBBlibc-2.1.2.so&dBBf:&BBBlibcom_err.so.2.0 &BBBlibcrypt-2.1.2.so &HBBh: &BBBlibext2fs.so.2.4&BB!4:\6 7 8 9 : ; < = > ? @ A B &BBBlibrt-2.1.2.so&2BB;8:d e f g h i j k l m n o p &BBBlibtermcap.so.2.0.8&BBBlibuuid.so.1.2&mxBBh:Br s t u v w x y z { | } ~ "&d,BB77 &&l,BBj: *&t BBGl: .&BBBlibnss_dns-2.1.2.so1&8BB͙4: 4&BBBlibnss_files-2.1.2.so7&BBBlibncurses.so.5.09&BBf: <&BBBlibpthread-0.8.so?&BBB/lib/libutil-2.1.2.soA&$BBBg: D&BBB/lib/libresolv-2.1.2.soG&-BBl5:  J&wBB77> N&BB?8: R&Y;BB 9:p q r s t u v w x y z { | V& BBBlibm-2.1.2.soY&X%BB77 \&BBBlibdl.so.1.9.9_&BBMs7 b&BBBlibdl-2.1.2.soe&dBB77h h&BBBlibdb1-2.1.2.sok& BBBlibe2p.so.2.3m&+BBs7      p&&BB77             t&BBBlibnsl-2.1.2.sow&ABBBZ ~& BBB/bin/mount& BBB/bin/umount&~BB#:D[ \ ] ^ _ ` a b c d e f g &!~BB:} ~  &J~BB>:( &$|~BB윤7B &$~BB`=: &BBBmke2fs&hl~BB8z &BBBhalt&8~BBu?: yz{|}~&BBBinit&D'~BBv=:&~BBs7&8y~BBZ:@ !"#$%&'()*+&d6~BBi=:?@ABCDEFGHIJK&$1~BBR=:NOPQRSTUVWXYZ&~BBp=:\]^_`abc&$~BB>: defghi&8~BBvo: jklmnopqrstuv& ~BBl@: z{|}~&:~BBW> &#BBB&T ~BB~ ?& ~BB~ ?&m ~BB:&R~BB|? &-~BBTW> '0~BB5<'P"~BBA '?~BB7"'L ~BB ?'~BB̛>'~BB螃>'~BB>$'x~BB ?)'ABB>:31'ABܸ46'#~756789:;<=<'DJ~BB.m2:(>?@ABCDEFGHIJA'~BBIl2:JRSTUVWXYZ[\]^F'BBBtsetJ'\I~BB::(wxyz{|}~N'0~BBVl2: S'o~BBU7:X'r~BB"7<]',~BBs7b'p~BBPl2: g'~BB:`l'P~BB:    q'0+~BBC7v'ɉ~~BBCq7B !"#$%&'{'L:~BBE7 <=>?@ABCDEFGH'~BBrAL'~BBE7MNOPQRST'~BBs7 UVWXYZ'~BB>['$ ~BB7\]^_`abcd'~BB>e'~BB2>f'@(~BBE7ghijklmnopq';~BB{X> rstuvwxyz{|}~'~BBX>'~5<'~BB1>'~5<'~BB5<'+ ~BB>' ~BBW>'`~BB>'~BB>'~BB+!>'ABB3!?'$l~BBؒ::'8O~BB7*' ~BB4:H'T~BBo4:.'E~BB8&     '` ~BB3!? !"#$(BBB/var/adm(ABBes< (ABBrڍ?  (g~BBrڍ?6 (~BBrڍ?r(,~BBrڍ?D(~BBrڍ?z     "(0~BBX>@ABCDEFGHIJKL'(~BB3!?DNOPQRSTUVWXYZ,(d~BB!?fpqrstuvwxyz{|1(ABB!?#5(~BBi&=$%&';( ~BBi&=()*+@( BBBfltstat2bitsD(p"~BB!?,-./012345678H(0~BB? M(~BB?R(ABB!?U(;BB!?     Z(BBBlibsnmp-0.4.2.5.so](~BB Ӊ?Ua(BB!?pVWXYZ[\]^_`abe(BBBlibucdagent-0.4.2.5.soh(~BB Ӊ?l(0BB!? p(BBBlibucdmibs-0.4.2.5.sos(~BB Ӊ?w(ABBS:{(ABB(S:(ABB?("~BBA=(J ~BBe=(U~BBʳ?N(ABB>=(f~;6(A<(BBBlibreadline.so.3.0(BBB/lib/libnss_dns.so.2(BBB/lib/libnss_files.so.2(BB2:(KBBٮR:|wxyz{|}~( BBBlibz.so.1.1.3( BBBlibz.so.1.1.3(BBB../../lib/libnsl.so.1(BBB/var/tmp(ABB#>:(ABB>:(ABBb>:((~BBb>:(ABB>:(w~BB>:(ABB+=(ABBCI:(ABBvCI:( ~BB@:(CBBt2:(BBBlog(ABBc:(CBB:)ABBt=)ABB15<)ABBL:d)ABBV+<)ABB<")K~BB<()8~BB<-)ABBB5)ABBB=)ABBBE)ABBBM)ABBBU)ABBB\) . .. devt bin etc lib  sbin1 usr var home root boot logsrootfs_0rootfs_1 tmp8proc . .. consoles cua0 cua1 fd0s fd0CompaQopefd0d360afd0h1200fd0h1440fd0h1476fd0h1494fd0h1600fd0h360fd0h410fd0h420fd0h720fd0h880fd0u1040fd0u1120fd0u1440fd0u1600 fd0u1680!fd0u1722"fd0u1743#fd0u1760$fd0u1840%fd0u1920&fd0u2880'fd0u3200(fd0u3520)fd0u360*fd0u3840+fd0u720,fd0u800-fd0u820.fd0u830/ hda0 hda11hda10UUU2hda113hda124hda135hda146hda157hda168 hda29 hda3: hda4; hda5< hda6= hda7> hda8? hda9@ kmemA memBttyS0 CttyS1D nullE ram0F ram1G ram2H ram3I ram4J ram5K ram6L ram7M tty0N tty1O tty2Ptty3Q tty4R tty5S tty6T tty7U zeroV msysaurandombrandomc cored porteloop0floop1g fdhstdoutistdinjstderrk nfsdl X0Rmsocksysn ttyoinitrdp fullqinitctlr logsptyp0tptyp1uptyp2vptyp3wttyp0xttyp1yttyp2zttyp3{ rtc|true0} palisade0~praecis0ttyS2ttyS3V . ..W flaX fla1Y fla2Z fla3[ fla4\ flb] flb1^ flb2_ flb3`|flb4 . .. sh@ cp@ cut dd df dircolors du ftp headhostname taripmasklogin lsmkdir more mv ping ash date ps pwd rm kill su trueumount@uname stty cat echosulogin edit ln dnsdomainname domainname syncmknodtouchchmodtelnet@chownfalsemountnetstat@@@@@@@@@@@@@t@@|@p@T@@@@p@@@@@@ @@x@t@@t@@@@H@@@@4@ @ @ @ELF04$f4 (444 \ \ \  ET]TT /lib/ld-linux.so.2GNUCG8&65!E?1."2>@,;0*#4B% 3) -FDC<$A 7/ =:+9 ('  !!",2)9@p;F/"N+Z d@kb s@zp=""Ў:"0"="@;"=";"0\;Џ="0$A;"&-3P7"93"@="EPMU`7"\pj"dАm;"u4"}p)P "$:"\";"@ \"Ѝ*(`: ="?gFl"O;"Ut"k 7"q`"__gmon_start__libc.so.6strcpytextdomainchownprintfstdoututimegeteuidgetopt_long__ctype_bgetenvdirnamememcpyreadlinkputs_nl_msg_cat_cntrmallocoptarg__dcgettextreaddirlchownftruncatelseekchmod__lxstatrenamestrrchrwritefprintf__stpcpymkfifo__deregister_frame_infooptindstdinumaskferrorreadstrncmpstrncpyunlinkrealloc_IO_getcsymlinkopendir__assert_fail__xmknodstrcmpeuidaccesssprintf__mempcpyfclosesetlocalestderrerror__xstat__errno_locationlinkexit__fxstatbindtextdomainrpmatch_IO_stdin_used__libc_start_mainopenstrchrclosedirmkdir__register_frame_infoclosefreeGLIBC_2.1GLIBC_2.0ii vii P5  "!`dChlp$tAx=|D/E #(-48 97<;&?) 3 B+, @:0F $2(.,'01468*<@%DHLUS[_trO7]5X%\%`h%dh%hh%lh%ph %th(%xh0%|h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h%h%hp%h`%hP%h@%h0%h %h%h%h%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@% hX0%h` %hh%hp%hx% h%$h%(h%,h%0h%4h%8h%<hp%@h`%DhP%Hh@%Lh01^PTRhh0QVh̞U=(u8P$С$8ut h@R(ÉUÍvUthh@!ÍvUÐUS]tU5\@t 9Dt#jhj. ‰@DR5 \\PPHt 9Lt#jh@j ‰HLR Pt 9Tt#jhj ‰PTRXt 9\t#jh`jR ‰X\R`t 9dt#jhj ‰`dRTht 9lt#jh@j ‰hlR1-SvUpWVS] oE}1у)̉uVWY]]C8uVEPuvX։ƒtEPhi2Ku~0tcEEUEPPW=tFWpt9tjhlj ‰ptEx(tkuuW tXtu}uAWxt9|jhjS ‰x|bu~,u;tjuE#pLVWƒtQWt 9t#jhj ‰R40j[C8/[^1e[^_UhWVSU] 1у)̉eREPf]]EPL+É1у)̉SV0SgE}WVE Љƒ g];/AvC;/t3j -Ɖ+EFEFE0WEPE Љƒ EEPEPƒtKEPt 9t#jhjv ‰R0}tyEPEPEP cE%=@tEEPt9jhj ‰E/C;/tj/SRÅhvE%=@tMVt 9t#jhj{ ‰Rjj E1e[^_ÐU4WVS]DžDž9|Tt 9t#jhj ‰Rjj_jdC9|Nt 9t#jhj ‰RjjjM L}WQjKƒ t6tPhiRjDž&PVQjƒ u󥃽E%=@DžM 4V)=,PVQ (à uGt 9t#jh3j@ ‰Rjj MqXPWyTt Lv1Rh)PSARV%ƒX҅uBX҅uZuQ|)vjRP1' ‰ӅuDžYjQEPSV =,t$MQ)PS SK A @9,)Ӄg=,tTt 9t#jh`j ‰RjjjE My 9PR'…E%=M1P!ÿuEIt 9 t#jh3j ‰ Rjj' v1ҋ|/QPjRƒ %=@1҃)ԉ㋅PSS+&S"‹1Ήމ+RPSkR` vjQEPSQ VP$t 9(t#jhj@ ‰$(Rjjj1[^_ÐUS]CCC CCCC CC$C(C,C0C4C8CDCHC<C@j5CLCPCT]UdWVSEM \hjhhhuMMQ hǃt=4hv=$h5Ã}QS5,t 90t#jh7j ‰,0R/jEEEEEEEEEEEEEEEEE|,nEE^EENEEvE9vE-vE!v4= jjhh$M QMQ==@t hChGhUlj=<t j}tT}tN4t 98t#jhj ‰48Rjj-j2}tW3E vE}uE}t EE4jFjdMQM QMQ 0}t50(UUE z<u#BLB@ÍvUSMU t(Y v9Zu9BuA9B u u1]ÍvUWVSEEp,UREuk tEPhQj3 Dt 9Ht%jhj? ‰DHQjj ];UUjSEPjSU RƃtuI Lt 9Pt%jhj ‰LPQjj+ jEPjUREPURRPEPVWo MEU (W1˃;9URh]Ee[^_ÉUtWVSuEEEȉMjMQE}vAuNM QMQTt 9Xt#jhj ‰TXRjjMQhPj ehhAM QME }GM Q\t 9`t#jhj* ‰\`Rv]SMQj cE؅tE EuVE%=uGSMQj t M"E%=uEԅ} ;E~EE$)ĉ{u1ۃ}tS>_?u tS{u Bt>9v"jVMQ E1ۅuVWMQS |qEMQWMQƃ }=t݋MQhPKL}tLjh MQ |MQMQ}!M Qh0jEMQU}!M Qh0jEMQ$}MQh0jEEe[^_UWVS}] DžDž}$t},t E,U(E|PURCXЉtURh1EURPuU R=duE(1rUtttx=@uP{8uJUR dt 9ht%jh!j ‰dhQjPPU RCXЉtoU RhQ1\9EuP9EuT9E{ }$t%E%=u`%=;t3{E%=`%={`%=tE%=uePU Rj uJPURjx u/9u!9u9uth{;uY{ uSE PUR lt 9pt%jhj* ‰lpQjjx@`%=@uJE P tt 9xt%jh@j ‰txQj{PtuM9%x@{ {jU Rotf`%PU R5\ |t 9t%jhj ‰|Q5XvE P5\ t 9t%jhj ‰Q5u}$%}$tZ`%=@uHU R t 9t%jhj/ ‰Qj `%=@QE PƃuI t 9t%jhj ‰Qjj' URVj}$t? t 9tdjhjR ‰=v t 9t%jh j ‰ыEPU RQjjzV v1у)̉VRVPU R Q8tGE P t9j jhWjV ‰@ Dž{ `%=@uXjU R%hE PZtU Rh31 DžE Ptj8t`U R t 9t%jhjs ‰Q0j{t T v{Tt!x@tE PURhs {}x@u[PU R t 9t%jhj ‰Qjj". E PR8 E Ph1/}$tRU REPu<{Tt !"#$%x@uU REPht},U,x@EP|RtGEP t9jhj ‰bU$ED$EUD$T$ u`%=@pCL!pppRE PstNU R t 9t%jh%j ‰Q40E P Z{TtU REPh {$t E EtU9U"E9EU(RSV|PWU REP9]{HfU:/&E PǃuI t 9t%jhj ‰Qjjj 1.)uOمtZPhBj| u@PWjf u*9u!9u9uWuGU R t9 jh`j& ‰E PURE PhD1v{tjU REPYU R t 9t%jhj ‰Q0Fvtt{t:t@t.tt"sDE PUR xutPSQU RE P t 9t%jhj ‰Q0xt`tt ttRSOEȋỦRQE PjU R t 9t%jhj ‰QJ0vthhWEP }PUR t 9t%jhj ‰Q0>v9E PW"tMU R t 9t%jh j ‰Qc0{(uċK uMQE P o)tu { TU R t 9t%jhAj ‰ Q0DEP t 9t%jh]j? ‰Qjj{0UUPPE P+t\U R t 9 t%jhsj ‰ Q0j#{4{(uċK uMQE P tstu{ u\U R $t 9(t%jhAj ‰$(Q_0j{4{<tcs@E PGkU R ,t90jhj ‰,0v{,u{uxtt@CL!RE PU R 4t 98t%jhj ‰48QD0jk{4r``E P DU R <t9@jhjv ‰<@cvthE PRtOE P Dt 9Ht%jhj ‰DHQT0j{d[^_ÍvUEuhhhh 8vhhhh @DHvhhhhÐUVS]sSh.hhh3wvuuVSjjjuu ue[^ÐUXS]EPSj |hdUMQRu.1ShK-0jT]ÉUuUMQRu UWVSu] PǍPG7_=` e[^_ÉU`@ P~HUWVSMu}E 11TU]t"ڐ] 9u9ru 9zuB 8RuA Q]A ] rzEB ]Z1e[^_ÉUWVS=`G9G jW=Nj]UG4EPwGSWNjMw=`W Uw}~*^vsKQR6WM}uU MQRuWe[^_UWVSU EE}1IM1:tPӉEPEP3ƒ u+;1IE9t*}uu vEF;u}u E e[^_ÍvU}uNcu u5\P5ÐUWVSu1эQ4уsʉUЃPkǃtbVW} tIW)f8.WPDƒ} utE8BRhS VW\j~SWe[^_ÉU WVSu #Et}E}1эq::t3Z 1эQF9rVSEPAƒ ;U~UEPƒuEP…uE1e[^_ÉUWVS} u1VWuu4<>.u.|7~u'L7 \BABЃ v9~uyt1ۉ؍e[^_ÉUS]t;u0hSI}PShj'v]UUЀ:tv8/uP@8uÐUS]5RtFLt 9Pt#jhj ‰LPRjS 5 tHTt 9Xt#jhjN ‰TXR0S]ÉUj6UWVSuj/Vu8/uH9w)xGP|Ãu1vWVS4؍e[^_ÐUWVS} uEt.VWUR_à }8tމ])эvEe[^_ÐUWVSu 1IM}эyED8PÃu1BWEPS] €z/u >/uJ >/t/B}tEE@PVRX؍e[^_ÐU WVSu uEVDEuEPQ]jvy .u y t[ڃy .tT+U M1)9v%9wVEPƒtG+EÉUEPSZEPuEPƒuEEP EP 1e[^_ÐUWS]1эQ~ 9/u IJe[_ÐU<thj58ÉUSuÃu؋]ÍvUSu uÃu؋]UW}W1QR‹}UVS1ۍu# t1C}vu DP u3C5`ƒu3VL%x[^ÐUWVSu uxÉ1эQуL wVP89wEDe[^_ÐUS[;'u uj]ÐUS['u uj]ÐUSD=DtЃ;u]ÍvUÐUS[&]alwaysautoneverabfildxPPpRS|suumv]VX<P@versionhelpversion-controlverboseupdatesymbolic-linksuffixrecursivepreservepathparentsone-file-systemno-dereferencelinkinteractivesparseforcebackuparchiveTry `%s --help' for more information. Usage: %s [OPTION]... SOURCE DEST or: %s [OPTION]... SOURCE... DIRECTORY Copy SOURCE to DEST, or multiple SOURCE(s) to DIRECTORY. -a, --archive same as -dpR -b, --backup make backup before removal -d, --no-dereference preserve links -f, --force remove existing destinations, never prompt -i, --interactive prompt before overwrite -l, --link link files instead of copying -p, --preserve preserve file attributes if possible -P, --parents append source path to DIRECTORY -r copy recursively, non-directories as files --sparse=WHEN control creation of sparse files -R, --recursive copy directories recursively -s, --symbolic-link make symbolic links instead of copying -S, --suffix=SUFFIX override the usual backup suffix -u, --update copy only when the SOURCE file is newer than the destination file or when the destination file is missing -v, --verbose explain what is being done -V, --version-control=WORD override the usual version control -x, --one-file-system stay on this file system --help display this help and exit --version output version information and exit By default, sparse SOURCE files are detected by a crude heuristic and the corresponding DEST file is made sparse as well. That is the behavior selected by --sparse=auto. Specify --sparse=always to create a sparse DEST file whenever the SOURCE file contains a long enough sequence of zero bytes. Use --sparse=never to inhibit creation of sparse files. The backup suffix is ~, unless set with SIMPLE_BACKUP_SUFFIX. The version control may be set with VERSION_CONTROL, values are: t, numbered make numbered backups nil, existing numbered if numbered backups exist, simple otherwise never, simple always make simple backups As a special case, cp makes a backup of SOURCE when the force and backup options are given and SOURCE and DEST are the same name for an existing, regular file. Report bugs to .%spreserving times for %spreserving ownership for %spreserving permissions for %scannot make directory `%s'`%s' exists but is not a directorymissing file argumentsmissing destination filevirtual memory exhausted%s -> %s ..when preserving paths, last argument must be a directorycopying multiple files, but last argument (%s) is not a directory/usr/share/localefileutilsSIMPLE_BACKUP_SUFFIXVERSION_CONTROLabdfilprsuvxPRS:V:sparse type4.0GNU fileutilscp (%s) %s cannot make both hard and symbolic linksؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠؠhؠĠؠؠРؠؠؠؠؠؠؠؠؠؠԟؠؠؠؠ(ؠؠ<ؠؠؠHؠtؠؠؠؠؠؠؠؠؠX%svirtual memory exhausted`%s' and `%s' are the same filecannot create regular file `%s'%s: omitting directory%s: cannot overwrite directory with non-directory%s: overwrite `%s', overriding mode %04o? %s: overwrite `%s'? %s: cannot overwrite directorybacking up `%s' would destroy source; `%s' not movedbacking up `%s' would destroy source; `%s' not copiedcannot backup `%s'cannot remove old link to `%s'%s -> %s %s: won't create hard link `%s' to directory `%s'%s: cannot copy cyclic symbolic linkcannot create directory `%s'.%s: can make relative symbolic links only in current directorycannot create link `%s'cannot create fifo `%s'cannot create special file `%s'cannot read symbolic link `%s'cannot create symbolic link `%s'preserving ownership for %s%s: unknown file typepreserving times for %ssetting permissions for %spreserving permissions for %srestoring permissions of %scannot un-backup `%s'valid_optionscopy.cco != ((void *)0)((co->backup_type) == none || (co->backup_type) == simple || (co->backup_type) == numbered_existing || (co->backup_type) == numbered)((co->sparse_mode) == SPARSE_NEVER || (co->sparse_mode) == SPARSE_AUTO || (co->sparse_mode) == SPARSE_ALWAYS)copyvalid_options (options)%s%s: invalid %s `%s' %s: ambiguous %s `%s' ~..~%d~numberedtexistingnilsimpleneverversion control typewrite error.Memory exhaustedP|Tvƍ֍&6FVfvƎ֎&6FVfvƏ֏&6FVfvƐ֐& 0 (ȇX v TP@oooRGCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)01.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.bss.comment.note# 1((07 XXp?ȇGoRR To 0c  l  8u PP  ~00 /`` 00X4EE`   \ @@\DD\LL\TT\TT]^e ^{{{cGeELF4p%4 (444(!(!(!((D0!̱̱ /lib/ld-linux.so.2GNU%&$  " !%  # "%),l3D":4+FxP"U43"Ztk"ryDd"d$Ĉ["|$3""ԉC*$tpĉ"""TԈ"+y1t:I[TH"q"__gmon_start__libc.so.6textdomainprintfstdoutungetcgetopt_long__ctype_bputsfeof_nl_msg_cat_cntrmallocoptarg__dcgettextcallocfprintf__deregister_frame_infooptindstdinferrorrealloc_IO_getcmemsetclearerrfclosesetlocalestderrerrorfwrite__errno_locationexitbindtextdomainfopen_IO_putc_IO_stdin_used__libc_start_main__register_frame_infofreeGLIBC_2.1GLIBC_2.0ii vii ȱlpt x| X\ `d$hlptx |# !% ıUS[_)|twOn]5P%T%Xh%\h%`h%dh%hh %lh(%ph0%th8p%xh@`%|hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h%h%hp%h`%hP%h@%ıh01^PTRhhQVhPU=0u8P,С,8uĈt h80ÉUÍvUTthh8ÍvUÐUS]tU5Tt t9t#jhj ‰tR5p 5Tt t9t#jhj9 ‰tRt t9t#jh@j ‰tRt t9t#jhj ‰tR%PUWVSMM}t0} t*}t$M9u'M @j@ Mu M 1M CNE9 MQǃEM @~@M MM 4)PR ‹MtM )MQMQ}jM;HM+؍e[^_ÐUU1ɡ,t9v;(w0<tÍvUWVSE1EE1Eh ElEЃ wM\AEQвtt9Բt$jh.j ‰вtԲRjj#j}-us}tPtt9IJt%jh.jb ‰tIJRjjjxEEt]1E농v,tM MxHu}Eu}=,;]sNȲt t9̲t#jh.j ‰Ȳt̲Rjjj,t9UsKC9r }=,2;ureMP}WK E}M<\FE1?vt=;ure}PMQ E}\F1EM(E19usU9v(ÃE9urPW ‰0(@PjR E9us;]}}vM;wv0B;vEE9urԋ}WgEe[^_UWVS}1Wà u5lj #ۉtFVlt5lS븅t 5lj e[^_ÍvUWVS1j! 8 v 8Mv}<PMQh$h à D;<t>=8u5lSjR~ | t5lj "vjmt5lCPj5 3V<tZt5l5<tO5lSMQÃ;<t* t*ύvtMQÃ;< u u%MQÃtMQS ;<uF t zu=8tt5lj t1Gve[^_UE=4u PPUVSuuFthKVÃuC@|SS$uuFt)Su!VhMT0jSn1e[^ÐUWVSu} 1ۋThPjhQhcThcz48<@`dK;b2,n1fvs=4tNزt t9ܲt#jhj ‰زtܲRjjkj 45tt9jhj ‰t=4tNt t9t#jhjN ‰tRjjjd45tt9t%jhj ‰tRjj?j8tZxtTtt9t$jhjz ‰tRjjj<8 jijhhmWV=Hth hhjv=Dt j=4uOtt9t$jh@j ‰tRjjj=<tW=4tNt t9 t#jhjB ‰t RjjjX=8tW=4tNt t9t#jhj ‰tRjjCj=<u < 9u3hIÃ&4 ÃH 9|ڃ=@t.5|2uhI0j 5l5luLt t9t#jh j ‰tR 0jA %PUS1ۃ}u jÃuHLt t9Pt#jhjk ‰LtPRj54؋]ÐUS]SSz]ÐUS]u S0uSW]ÉUSE] u SSPuS$]ÐUS<=<tЃ;u]ÍvUÐUS[×G]bcfdsDHversionhelponly-delimiteddelimiterfieldscharactersbytesTry `%s --help' for more information. Usage: %s [OPTION]... [FILE]... Print selected parts of lines from each FILE to standard output. -b, --bytes=LIST output only these bytes -c, --characters=LIST output only these characters -d, --delimiter=DELIM use DELIM instead of TAB for field delimiter -f, --fields=LIST output only these fields -n (ignored) -s, --only-delimited do not print lines not containing delimiters --help display this help and exit --version output version information and exit Use one, and only one of -b, -c or -f. Each LIST is made up of one range, or many ranges separated by commas. Each range is one of: N N'th byte, character or field, counted from 1 N- from N'th byte, character or field, to end of line N-M from N'th to M'th (included) byte, character or field -M from first to M'th (included) byte, character or field With no FILE, or when FILE is -, read standard input. Report bugs to textutils-bugs@gnu.ai.mit.eduinvalid byte or field list-r%s/usr/share/localetextutilsb:c:d:f:nsonly one type of list may be specifiedmissing list of positionsmissing list of fieldsthe delimiter must be a single character1.22GNU textutilscut (%s) %s you must specify a list of bytes, characters, or fieldsa delimiter may be specified only when operating on fieldssuppressing non-delimited lines makes sense only when operating on fieldswrite errorMemory exhaustedH̱*:JZjzʈڈ *:JZjzʉډ  (\ v LĆ@oooFGCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)01.0101.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.bss.comment.note# 1((47 \\`?GoFFLTo0c Ćl ̆8u  ~/ H ((!88!<Ív    9 r?vC;r$Uv$9u-9s(   9 r$GNBe[^_ÉUWVS}u E9u];]$$9r.$M   d]:u?i    9 rv =u ] 9 rE9u,e[^_U WVS1PEEt5 v] t,uV55VS559 t.555VS55 ujJ.  9w9%=u5juV 5]S5kE }Z5hؿo0jN5j55 2E1 9s?t4uEU)QjRJ E u;5usuV5 })5hؿ0j4LjE;ujU=tu]S=}EPuVEtuPItuPuPv=tctjhItjh3v    9 rGv tS$tJE;s?  ; r E];rt=9$u0  ; r tTQ55 ~})5hؿ}0j,jEP;EtPe[^_ÍvUWVSu hj hhZhv KIyVu=t!hhh j=t jP t2jQ}`5hؿn0jB t 9t%jhj[ ‰щ  ; u< t 9tajhj ‰: t 9t%jh j ‰Q t 9t%jhj ‰Qjj @B uuBhSQ }5hؿ0jEUE U=1ۡEU5uUu11;Mu;]tI t 9t%jhjo ‰Qjj V5}b5hؿ0jD t 9t%jh j ‰щ h,j2h,j&h,j hj  7VUS]5tFt 9t#jh3jR ‰RjS 5tHt 9t#jh3j ‰R0SW]ÉUj6UWVS} uEt.VWURà }q8tމ])эvEe[^_ÐUtWVS]uM}ىM EC EC 9WE虉EUEeƉ׋MMϋMM EEEURPWVC EUU;Uu E;E m}jjEU RP}-`m}m܃$XZEUEM}u$hISEE Ƀ}wEÈ@rU@V$hNS}1ImvV$hUSZ؉vșEؙÉVSEU RPH EЉUEUԉEUU Uș}؉EȉɉMVSEU RPƉ׋UȉUE9E}}‰EvU9U} E vE}bEEUĉEU9}Iu 9u>EEUĉEU9}u 9u}EURPWVUEUMMș}EыEE}UJEURPWVƉ׋UU;]}]ЉU]9]}ME9}DME@UwVu wOEE~E@E} u Ew#u wMU0EHE.EE왉EUM]wuv E@ I}~BE9u09u,}w&UAEH0HE.vMjj WVӀ0U jj WVӉΉ߉u }uŋEe[^_ÉUVS]u u2hÃuht ^UhlS | 9hEPjEPSwu#E8tE} 1e[^ÐUS]uSL} trt_CvSt 9t#jhj ‰RhSt 9t#jhj ‰RhBS t 9t#jhjn ‰ Rh jj]ÐUWVS} uu1 8uVWURà |؍e[^_U塔thHj5hÉUSuÃu؋]ÍvUSu u1Ãu؋]UWVS] E E1u 9u E1e[^_ÍvUWVS}u ]Kt vVWt  vs1>?@ABCDEFe[^_ÐUWVS}}$vh`jvhihu uuB< t< t:-t/jMQVW E;9u v}:PMQu j0MQt@EM1e[^_UWVSU EE}1IM1:tPӉEPEP3ƒ u+;1IE9t*}uu vEF;u}u E e[^_ÍvU}uu u5P5ÐUWVu} EU9|9s19we^_U WV}EEUUM MuC9vЉE}u 1NjE1EUEEvU9Uv EuuM9Mw9}rމEwvE )uE}MmU ЉEEEMmEEEMmE EeEUuEUƉ;}wu;uvMEMMEEEUe^_U(WVUUMMUUUUM M؃}uT9Mv Љu&}u 1uEE1uU؋EuU}u1M1yU9Uvu׉u}MMu8U9UwM9MrM؋U+UMM؉U}u}E M)MeEM EMeU؉U܋Mm܋MEM ‰U؋MeЋUuUeU܋M9wu;Ev U+EUU܃}t+M؋U)M܉M؉ȋMM Ƌ}U2zEUe^_ÐUS=tЃ;u]ÍvUÐUS[7#k]syncnotruncnoerrorswabucaselcaseunblockblockibmebcdicascii7-./% <=2&?'@O{[lP}M]\Nk`Kaz^L~no|JZ_myjС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx    [.<(+!&]$*);^-/|,%_>?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ0123456789@8versionhelpTry `%s --help' for more information. Usage: %s [OPTION]... Copy a file, converting and formatting according to the options. bs=BYTES force ibs=BYTES and obs=BYTES cbs=BYTES convert BYTES bytes at a time conv=KEYWORDS convert the file as per the comma separated keyword list count=BLOCKS copy only BLOCKS input blocks ibs=BYTES read BYTES bytes at a time if=FILE read from FILE instead of stdin obs=BYTES write BYTES bytes at a time of=FILE write to FILE instead of stdout seek=BLOCKS skip BLOCKS obs-sized blocks at start of output skip=BLOCKS skip BLOCKS ibs-sized blocks at start of input --help display this help and exit --version output version information and exit BYTES may be followed by the following multiplicative suffixes: xM M, c 1, w 2, b 512, kD 1000, k 1024, MD 1,000,000, M 1,048,576, GD 1,000,000,000, G 1,073,741,824, and so on for T, P, E, Z, Y. Each KEYWORD may be: ascii from EBCDIC to ASCII ebcdic from ASCII to EBCDIC ibm from ASCII to alternated EBCDIC block pad newline-terminated records with spaces to cbs-size unblock replace trailing spaces in cbs-size records with newline lcase change upper case to lower case notrunc do not truncate the output file ucase change lower case to upper case swab swap every pair of input bytes noerror continue after read errors sync pad every input block with NULs to ibs-size Report bugs to .%s+%s records in %s+%s records out truncated recordtruncated records%s %s %s%s: invalid conversionqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqq,q4qqqqqDqqLqqqTqqqqqqqqqqqqqqqqqq<qqqqqqqqqqq\lunrecognized option `%s'ifofconvibsobsbscbsskipseekcountunrecognized option `%s=%s'invalid number `%s'only one conv in {ascii,ebcdic,ibm}, {lcase,ucase}, {block,unblock}, {unblock,sync}/usr/share/localefileutils4.0GNU fileutilsdd (%s) %s standard input%s is closedstandard outputfile offset out of rangewrite errorkMGTPEZY%.0f%.1f%c%.0f%c?@{xsihuman-readableBLOCK_SIZEPOSIXLY_CORRECTeEgGkKmMpPtTyYzZ0block sizeinvalid %s `%s'invalid character following %s `%s'%s `%s' larger than maximum long intMemory exhaustedHxstrtoulxstrtol.c0 <= strtol_base && strtol_base <= 36 (,0DH `$(4%s: invalid %s `%s' %s: ambiguous %s `%s'   ڵ@յ͵ŵ\N^n~Ίފ.>N^n~΋ދ.>N^n~  l(ԅ  @Ȉ@oXooGCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)01.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.bss.comment.note# 1((l7 @?ԅGohToXX0c l 8u Ȉ@ ~ /88 Ȍ (ll55  GHHHH\\IJ JM@OELF,4K4 (444BBBHC /lib/ld-linux.so.2GNU%6,$ .0&4  '-52/*3)( +! %#1" !! ",)3x:\+FMb U܌7"\<"a,l}L:"|̌2 į0 l<$\"7"|3"܋ /j"$ ".̋]6L'"@ N̊)U"\$d,ku||"{|\,""l="gt"܊7""__gmon_start__libc.so.6strcpytextdomainprintfstdoutgetopt_longgetenvdirnamefchdirputs__overflow_nl_msg_cat_cntrmallocoptarg__dcgettext__strtoul_internal__umoddi3__udivdi3abortstrrchrfprintf__deregister_frame_infochdiroptindferrorstrstrstrncmpstrncpysyncreallocsetmntentstatvfsendmntent__assert_failstrcmpgetcwdsprintffclosesetlocalestderrerrorgetmntent__xstat__errno_locationexitbindtextdomain_IO_stdin_used__libc_start_mainopenstrchr__register_frame_infoclosefreeGLIBC_2.1GLIBC_2.0ii ii x|( (,20*4 83<#@4DHL"P'T,X \ `dh+l.ptx| 0&!1-5$ %)US[Htu?(]5 %$%(h%,h%0h%4h%8h %<h(%@h0%Dh8p%Hh@`%LhHP%PhP@%ThX0%Xh` %\hh%`hp%dhx%hh%lh%ph%th%xh%|h%h%hp%h`%hP%h@%h0%h %h%h%h%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@1^PTRhh<QVhU=u8PС8u\t hÉUÍvU帼thhÍvUÐU0WVShA=t hh"=t hv }hfvhjEPșRPÉ1Iv'jh<wVo u GPVShh&e[^_ÍvUVSutuÉ3Vt[u1e[^ÐUVSut)u #É3Vt[u1e[^ÐUEU utuuuRPv3ÐUWVSu}t =}t=u =EPUR/] uEPVS t#Sh5D0j rE Eu=u =Tu3}uE3=1эY}򮉝t)tt.URDžt)ttPVh8iv=uURVh@7vEPVhJ(1I~ =uhPVhQ+ VhY=5=|Upu}tMEt9w uLp9UvADžDžDžDžEU]uEU؉+t p߭۽jjRP}-ۭ۽ۭݝ܍VS,$۽ݝjjVS:}-ۭ۽ۭ$XZx|݅xܽݝDžDžWjlEPRPXQWjURRP;QWjSEURP$Qh_$ܝEu hmhs} Dž Dž uԃu}t]M9wu9uvuԋ}+u}E䉅u }hEU艅hlhtl tU쉕t'ك9u,9"M;9u;EWV,$۽jjWV }-ۭ۽ۭݝ܍RP,$۽ݝjjRP}-ۭ۽ۭ$XZx|݅xܽݝ/DžDžEU艅U쉕PuЍRtكSQ}tI-QP5uЍ(IRWVaQP5uSEԋURP=QRh{ܝEuhh } tU Rh xY;Yr j QB A\[^_ÍvUVSut53V0uCPCPss3[ujjjjVe[^UWVS]u DžDH@Q&u/F%=@u(M<Ss}V1SJV VD V8WBW*|ǍM3CPjss3MQh50jie[^_ÐUMU B%=`t= u QRQÍvUSt+CPCPss3Y[u׋]ÉUS]j2‰B]ÍvUS]j ‰B]ÍvUS]tU50t 9t#jhj ‰R5|5 50t 9t#jhj ‰Rt 9t#jh@jN ‰Rt 9t#jhj ‰RSUWVS} 0hPjahɺhۺhۺ8hjhP  =$~rfZNBhj5 +5v5 vj-jhh} W}W =t hhhj=t jE5t~tm36uT6t 9t#jh@j ‰RjjE [uvu}tjY;UE)ЍPR E5;u}^} +P}R3j t(3h50jRF;u|1=u=u=u =tPuLt 9t#jhjT ‰R0j =t}9=u [^ME;]}3} 4t+P}RQC;]|5US]5xtFt 9 t#jhjj ‰ RjS 5xtHt 9t#jhj ‰R0So]ÉUj6UWVSuj/VuĽ8/uH9w)xGPpÃu1vWVS؍e[^_ÐUtWVS]uM}ىM EC EC 9WE虉EUEeƉ׋MMϋMM EEEURPWV;EUU;Uu E;E m}jjEU RP }-m}m܃$XZEUEM}u$hSEE Ƀ}wEÈ@rUV$hS}1ImvV$hSb؉vșEؙÉVSEU RP@EЉUEUԉEUU Uș}؉EȉɉMVSEU RP Ɖ׋UȉUE9E}}‰EvU9U} E vE}bEEUĉEU9}Iu 9u>EEUĉEU9}u 9u}EURPWVM EUMMș}EыEE}UJEURPWV Ɖ׋UU;]}]ЉU]9]}ME9}DMEUwVu wOEE~E@E} u Ew#u wMU0EHE.EE왉EUM]wuv E@ I}~BE9u09u,}w&UEH0HE.vMjj WV Ӏ0U jj WV| ӉΉ߉u }uŋEe[^_ÉUVS]u u2h4xÃuh?et ^Uh S | ,9hOEPjEPScu#E8tE} 1e[^ÐUS]uSL} trt_vSt 9t#jhaj ‰RhlS t 9$t#jhaj ‰ $RhBS(t 9,t#jhajv ‰(,Rhjj]ÐUS]C=t(jh} hv=u'Cuh0jh1]ÐUWVSu}1ۋ|LPtiu"Pt#"PE u*PhB30j%v}vhZ 0j؍e[^_US]| PCtPA]UWS]1эQ~ 9/u IJe[_ÐUWVSVE&_Ã;"u, VUREVURǃtȅtEvƋUR~1e[^_ÐUth`j5ÉUSuÃu؋]ÍvUSu uyÃu؋]UW}W1QR_‹}UWVS] E E1u 9u E1e[^_ÍvUWVS}u ]Kt vVWt  vs1e[^_ÐUWVS}}$vhjvhhu uuB< t< t:-t/jMQVW&E;9u v}:PMQu j0MQ}t@EM1e[^_UHWVS}EPu} E…tu}t u EEt1 GWEăt1 G WMȉ1%1҃ ։_wOẼt1 G W$EЃt1 G(W,1e[^_ÐUS]1ɊtN<wL.<wLЀ wLC„uȋ]UWVSMMhhvEsvj ËM1IMq./usr/share/localefileutilsDF_BLOCK_SIZEaiF:hHklmPTt:vx:4.0GNU fileutilsdf (%s) %s file system type `%s' both selected and excludedcannot read table of mounted filesystems6,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, ,,,,,,,,М,,,Ĝ,,,,,,,,,,,,\,,,,,,|l,,,,,,, ,6,,,,,,,,ܜwrite error.kMGTPEZY%.0f%.1f%c%.0f%c?@sihuman-readableBLOCK_SIZEPOSIXLY_CORRECTeEgGkKmMpPtTyYzZ0block sizeinvalid %s `%s'invalid character following %s `%s'%s `%s' larger than maximum long int.cannot open current directorycannot get current directory from saved working directorycannot return to %s%s%s%sMemory exhausted`xstrtoulxstrtol.c0 <= strtol_base && strtol_base <= 36LTX`dh|D\`l/etc/mtabrautoignoredev=%s: invalid %s `%s' %s: ambiguous %s `%s' ŠҊ"2BRbr‹ҋ"2BRbrŒҌ" < (  X0oooGCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)01.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.bss.comment.note# 1((t7 `?GolTo0c l (u X ~<< /ll ,, %22  BC  CCCCxxDxDyIKELF4X 4 (444 /lib/ld-linux.so.2GNU      |)!(2 9<"?rFN$Vl)],"uL7"{Z"܆R܅);"y̆D\̅t"__gmon_start__libc.so.6printfstdout__ctype_bgetenvfgetsperrorstrrchrfprintfstrcat__deregister_frame_infochdirstrcasecmpmemsetstrcmpfclosestderraccessexitfopen_IO_putc_IO_stdin_used__libc_start_main__register_frame_infoGLIBC_2.1GLIBC_2.0ii ii   Ĭ Ȭ̬ ЬԬجܬ US['XtVz. ]5%%h%h%h%h%h %h(%h0%h8p%Ĭh@`%ȬhHP%̬hP@%ЬhX0%Ԭh` %جhh%ܬhp%hx%h%h%h1^PTRhhQVh?U=u8PС8u,t hÉUÍvU̅thhAÍvUÐUWVShdÃt;uURh52_j/Sƃt F Hރ=t#13VtՃ;uVURh5e[^_UVS]u U DA t BDA u<#t~ DA u:tfBDA tB DA t BDA ut6<#t2v<#tBuJ DA t JDA uBe[^ÉUVSuU UH<=t<:t$<\t<^uvt5j\5PpFuE5PVe[^ÍvU,WVS1DžDžhjP DžDžDžM9M 8-Xx*wg$DžxDžlDž`DžTDžHDžhh u=hh*hWuM 1jRh:t8u Dž?t t! h`hDžQPP: 8^h:PuNQuDžDž Džu Dž<.u05j*#j=Gj::<*uj=R(j:hRu"hS]SQKh|uit(h;j:M 1h5QhQ SQt Džt(tAvt+3Dž&Dž-DžDž; DžhHÃtg_C<:th>xH84hjhHCPr =$tXdqajEPjj5uE|=~P5`t 9dt#jhfj ‰`dRjjHEpv\`l8|hpj 55H tV5h0j855H+ "hj5 jj;jhhVWMQ =Dt!hhh=< j=@t jj=XtMht 9lt#jhjE ‰hlRjtP=puGpt 9tt#jhj ‰ptRjjL tltZptQPxt 9|t#jh@j ‰x|Rjjjjt pjFjdjdh$ ;EuEPS 5<'vU$u5hEPUM QR Ph5UWVS]EEPtjhh)j tN t 9t%jhjo ‰Q0j UEU;ސ1уu;/uj5v</uS5=duajjjjS'hh)j th)J0j U9uE9uU9Qt[j t 9t%jhjD ‰QEPs t j#v>=dtR t 9t%jh-j ‰QtxRP URe[^_UWVS]u}} t!=lthSjg |2hS8Ѓ}ph0j4=\u.=v%RP5  EUtx@EU=`t} u;u;}E=8u+EPSj uUЉU}tEP"tjHSR}Sp t 9t%jhj ‰Q0j5 h)ƃ phQj}t.phʽ]S t jrS>dhʽn}Sp t 9t%jhj ‰Q0jt< v t 9t%jhj ‰Qjj h!5@E>ٱ5<uBS5E@PEURPjS|UEUUR5$1ˀ;uV}tphʽ]S) S ehʽ}Vp t 9t%jhj ‰Q%0jUJR5!E;p~} t$ ytI!QEURP =huM] ȉE=Xt U;p~} t% ytI!QEURPEUp[^_UWVS]u PWljPJGw= e[^_ÍvU@ P~HUWVS=G9G r|jW Nj]UG4EPw GSW NjMw=w l_~SKQR3W$NU MQRuWe[^_UWVSM] u}11TUUt$Ѝv9u9pu9xu +v@ uA AUA pxUP 1e[^_UWVSu] j ǍCP G>e[^_ÍvUVS]u 93sFPs C3e[^ÐUWVS] 1эqVEPSEpEEpe[^_ÍvUWVS] Ep1э|WEPiSEpVExe[^_ÍvUMU 9Qv AQÐUS]5tFLt 9Pt#jh#j ‰LPRjS@ 5btHTt 9Xt#jh#j ‰TXR0S]ÉUj6USj  CC@h ؋]ÉUWVSEx19}(։jM Q6K u C9|1e[^_ÉUVS]CK94EsP3 KE Ce[^ÉUWVSU MME:-u zȉM1E}u!h/REu Mh ǃ>F9uuSW ǃMQuԍFPW NjMQ t E}uMQkt _E9w29s M8 t v9s{tPMQCC9vM1e[^_ÐUtWVS]uM}ىM EC EC 9WE虉EUEeƉ׋MMϋMM EEEURPWV EUU;Uu E;E m}jjEU RP/ }-`m}m܃$XZEUEM}u$hISEE Ƀ}wEÈ@rU@V$hNS}f1ImvV$hUS:؉vșEؙÉVSEU RP EЉUEUԉEUU Uș}؉EȉɉMVSEU RP+ Ɖ׋UȉUE9E}}‰EvU9U} E vE}bEEUĉEU9}Iu 9u>EEUĉEU9}u 9u}EURPWV EUMMș}EыEE}UJEURPWV. Ɖ׋UU;]}]ЉU]9]}ME9}DME@UwVu wOEE~E@E} u Ew#u wMU0EHE.EE왉EUM]wuv E@ I}~BE9u09u,}w&UAEH0HE.vMjj WV& Ӏ0U jj WV ӉΉ߉u }uŋEe[^_ÉUVS]u u2hPÃuh=t ^UhlSa| 9hEPjEPSu#E8tE} 1e[^ÐUS]uSL} trt_vS\t 9`t#jhj ‰\`Rh̾Sdt 9ht#jhj ‰dhRhBSlt 9pt#jhjN ‰lpRh jj]ÐUS]C=|t(jhE} hGv=|u'Cuhey0j@1]ÐUWVSu}1ۋ|LPtiuPtPE uPh 0j%vh}vh0j؍e[^_US]| PiCtP]U WVSu uEVEuEP]jvy .u y t[ڃy .tT+U M1)9v%9wVEPƒtG+EÉUEPSZEPuEPƒuEEP EP#1e[^_ÐUWVSVE&sÃ;"u, VUREVURǃtȅtEv/ƋUR1e[^_ÐU塄thj5ÉUSuÃu؋]ÍvUSu uÃu؋]UWVS] E E} 9u E1e[^_ÍvUWVS}u ]Kt vVWt  vs1e[^_ÐU WVS}}$vhjvhhu uujMQVMQzE;;Uu :EPWu j0Wt@EM1e[^_UWVSU EE}1IM1:tPӉEPEP3Uƒ u+;1IE9t*}uu vEF;u}u E e[^_ÍvU}u 5u u5tP5ÐUWVu} EU9|9s19we^_U WV}EEUUM MuC9vЉE}u 1NjE1EUEEvU9Uv EuuM9Mw9}rމEwvE )uE}MmU ЉEEEMmEEEMmE EeEUuEUƉ;}wu;uvMEMMEEEUe^_U(WVUUMMUUUUM M؃}uT9Mv Љu&}u 1uEE1uU؋EuU}u1M1ytuvwxyz{|U9Uvu׉u}MMu8U9UwM9MrM؋U+UMM؉U}u}E M)MeEM EMeU؉U܋Mm܋MEM ‰U؋MeЋUuUeU܋M9wu;Ev U+EUU܃}t+M؋U)M܉M؉ȋMM Ƌ}U2zEUe^_ÐUS[Ã#u ujW]ÐUS[_#u ujs]ÐUS=tЃ;u]ÍvUÐUS[ #]ڳaϳɳblLDX|hyHoke[mKx=S3s-c(@ Dversionhelptotalsummarizeseparate-dirsone-file-systemmegabytesmax-depthkilobytessihuman-readableexclude-fromexcludedereference-argsdereferencecount-linksbytesblock-sizeall%s: %s Try `%s --help' for more information. Usage: %s [OPTION]... [FILE]... Summarize disk usage of each FILE, recursively for directories. -a, --all write counts for all files, not just directories --block-size=SIZE use SIZE-byte blocks -b, --bytes print size in bytes -c, --total produce a grand total -D, --dereference-args dereference PATHs when symbolic link -h, --human-readable print sizes in human readable format (e.g., 1K 234M 2G) -H, --si likewise, but use powers of 1000 not 1024 -k, --kilobytes like --block-size=1024 -l, --count-links count sizes many times if hard linked -L, --dereference dereference all symbolic links -m, --megabytes like --block-size=1048576 -S, --separate-dirs do not include size of subdirectories -s, --summarize display only a total for each argument -x, --one-file-system skip directories on different filesystems -X FILE, --exclude-from=FILE Exclude files that match any pattern in FILE. --exclude=PAT Exclude files that match PAT. --max-depth=N print the total for a directory (or file, with --all) only if it is N or fewer levels below the command line argument; --max-depth=0 is the same as --summarize --help display this help and exit --version output version information and exit Report bugs to ../usr/share/localefileutilsDU_BLOCK_SIZEabchHklmsxDLSX:invalid maximum depth `%s'%s4.0GNU fileutilsdu (%s) %s cannot both summarize and show all entrieswarning: summarizing is the same as using --max-depth=0warning: summarizing conflicts with --max-depth=%d( ,88ԐpH%s %s current directorystarting directorycannot change to directory %s..cannot change to `..' from directory %svirtual memory exhausted/write errorrkMGTPEZY%.0f%.1f%c%.0f%c?@{xsihuman-readableBLOCK_SIZEPOSIXLY_CORRECTeEgGkKmMpPtTyYzZ0block sizeinvalid %s `%s'invalid character following %s `%s'%s `%s' larger than maximum long int.cannot open current directorycannot get current directory from saved working directorycannot return to %s%s%s%sMemory exhaustedxstrtolxstrtol.c0 <= strtol_base && strtol_base <= 36,0H xstrtoulxstrtol.c0 <= strtol_base && strtol_base <= 364%s: invalid %s `%s' %s: ambiguous %s `%s' Xʊڊ *:JZjzʋڋ *:JZjzʌڌ *: T (  XĈ8ooo&GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)01.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.bss.comment.note# 1((t7 `?)Go&&lTo0c Ĉl ̈0u X ~TT / DD D$11 LLD<DDDDXXEFx FKLELFԙ4 4 (444aa mm /lib/ld-linux.so.2GNUao5V< 3\P+LBRlk2>nhQ$?a% UF;_:"60d4) =1I^gCAZjHX&,' *K(mJE7.G-M ebN[STY8@`9O]/DifW#!c !m*l@ F$+L`n]$fbę!D)dnT:"T)R'"lnĔb"@rd/"$$3"#:"*Ę."14J"<Ԗ?"B4:"IDI"Pd"X"_t="eԘm"q:"v;"|yD2:""T="$4)T:4"7"d:pn#"Ԕ7"ԓ3"" =" '47".4Z"9ėJBt{HDQ:X/"]t$dlt\vg"|;"ĕ4"tt)ԕ:"d"$D"$$hn !;"T\ "1T6Ė\?yENd<UD+dd%k$}gԗl"Dt"7"OF":$+PnPnL__gmon_start__libreadline.so.3_DYNAMIC_GLOBAL_OFFSET_TABLE__init_finirl_terminal_namereadlineadd_historylibncurses.so.5libc.so.6strcpyprintfstdoutgetloginconnectstrerrorfdopensnprintf__ctype_bgetenv__strtol_internalfgetsmemcpyexeclpcloseperrorgetuidgetpassfeofmallocisattysiglongjmpsleepsocketselectreaddirfflushlseekstrncasecmpsendchmodpopen__sigsetjmpacceptstrrchrrindexwritefprintfstrcatbind__deregister_frame_infochdirsetsockoptfseekstdinwaitumaskferrorsignalreaddirfdstrncmpstrncpyunlinkstrcasecmp__strdupbcopy_IO_getclistenforksscanfstrncatinet_atonindexgettimeofdayinet_ntoaopendirherrorstrcmpshutdowngetpwuidgetcwdgethostbynamegetpwnamgetservbynamegethostnamesprintffclosestderrmkstempaccess__xstat__errno_locationexit__fxstatfopen_IO_putcfileno_IO_stdin_usedgmtime__libc_start_mainstrchrclosedir__register_frame_infoclosevfprintffreegetsockname_etext_edata__bss_start_endGLIBC_2.1GLIBC_2.0ii ii m`ndn hnWlnpn5l8 l$lF(ld,l0l4l8lf!ılll*l'llll(llll1l)ll3lll4l2ll;lll<lcl/l l0mm$m mVmjm+m@me mI$mK(m,mT0mQ4m?8mRf:~Sjj jq:ƒf2E pph+kE 0h+\KfM Pq::`LascifdLihj h ,h, (strefam:(file(;f L8(:=tE p=E=)u h",?u^}tXEj hDÃuj hDÃt{.uKEhDh',tE@]1IэQv9vщ޿B,Aj1эQwF@H΅t4u0AHσv!uBH˃vu CH޿B,1tҀu|jhB,S ud=;tK vh`LbinafdLryfL}h`Lh`, =;tK v}}1I эQv 9vщ޿,Aj1эQwF@H΅t4u0AHσv!uBH˃vu CH޿, 1tҀu"j h,S u h,Ee[^_ÉUVSua=at3Vt;u;uVh-QKOC t8tPsh-< sh%-<u3h`LChe[^ÍvUSEU ~Y2h--9-a=at v3Ph;-@- ;uhD-K)h`Lh`,pKr]ÍvUWVS]5=,:u;=)u} u ,:a=at;Xt8u8uSh`-Iu= Lth Lph-<;ph%-+;u5=,:e[^_UhT,ÐUh,ÐUh,ÐUhh-FKÉUhh-&KÉUh(h .KÉUWVS1EuEU BBGEhF.E PMQ t}9hQ.E PMQ u E 0h`.KE p@EV"!‹E PƒBuKv9t 9ruBU 8at=t ...t<= :tr$‹E Pƒ=;tr&‹E P19ruM9JtPrE pS=e[^_ÍvU WVS}:h.E P}W u!E 0h.^KAvE )h(jjh=;jG;u)2=)%SE 0ڃ=Ktc:t& lnDAuB:tDAt:u2ڍt5lnDFt BAu鍕= :t R#ƒ=;t R$ƒ19u =`uPRS=t..PE<=)u;=;t25``h.h.t)5`ju  Ã|Dž\==);E 40?= :tE 4 " E =;t Re#1ɋE ;u =`uQRE 4=t..P;=)=;}5``h.h.ut)5`FE 4`DtPh.R=)PE 0= :t3 =;t R'"19u =`uPR3=t ..P9=)u;=;t25``h.h.Qt)5`!tWjW;}Wj)[^_ÍvUh.ju u/ÐU=Tjt..Pju uÍvU,WVSDžUuEE @} GUhQ.E P}Wƒ t!}= :tE p ‹E P=;tE pg‹E P}WE pj ƒ }u?}+&0PE ph/5hn(v,TjD<=)u E ph/2WPWPWPh/h@d @WEYCAQ+)‹q9HuhS99uYQ 9*uJQ9u;Q9 u,9~"^vh@h.uB1ҋM 9yu 9AtRuqE ph:/>Tj1[^_ÉUSh?/5dn=)tI=;t@``5h.t`jh`)jhUWVS}:hA/E P}W u!E 0hN/^KvE )h(jjh<;u)&=)SE 0ك=Ktc;t&lnDBuA9tDBt9u2ٍt5lnDFt ABu鍍= :t Q$=;t Q19u =`uPh.SQh:/<=)u;=;t2``hf/h.t)`5;u 0ÃWjM)[^_UWVS]=)u?=u~pvXb`PXbK=u7~u~؍P~@n~_v=Xbjhk/}W' j?mW%EV\ }} h/U5))} t1=;%P.Kjh/PWh/:uW?} t=;%PJU5)h/URXbuh/1Ov5Xbhhn? u5XbXbƐj hntne[^_U}t//ÐUVS=:t5)h/jh/Z=;uAjI=:t5)h0+h%0jIh(hh`Lhh@05DP5`8P5:)P5Ph0,5:P5Ph05LP5KPh0_ = :thphKh1? h1.=;th*h;h)1 hA15 :PP5)DPh`15,:+Ph1=~6h11ۃ;}Vh1C;|Ke[^ÐU=:%:PPh1D:KU=Xk%XkP{Ph1XkKU=)%)t=,:tG5)0Ph1)K thh1h2ÉU=,:%,:=)t tg5,:Ph 2U,:K th(h"25h2(ÉU=%PgPh=2KU= :% :P3PhO2 :KU=`%`PPhe2`KU=%PPh{2`KUS] }~/jj js})sh2%K[=)%)t : v%:)PPAPh2=)ƒK]ÐU}7h2E PUR uE 0h2KMvE ph2&u2=Ku&=t h3AE ph)3&USEU u13-t2h33Kr ÃuKS:}+0PSh/5hnKThSu&8"uj hN3S Dž???Sh]3OKÐU}7hQ.E PURM uE 0hu3 KvE ph3p%ÉUS}7hA/E PUR uE 0hN/KE )h(j$Ejhu;u)pv=)tdSE 0 tRSh3$=)u;=;t2``h3h. t)`ju IÃhURji)]ÉU}h3E PUR t}4h3E PUR uE 0h3hK(E ph3#uE ph3#ÉUVSE] @C@C\b~3h3Kv8nu /4SuBtRz CtSuBt+:|t&RR CtPh4Y xjh.ssV0e[^U WVS}hA/E P}Wc t}:hF.E P}WD u!E 0h@4KTvMU DEDUuBt3E8|t+EPw EEtEPh4xtE xlu /v4EE )h(jEjhI=)EH9}xu./jPE 4EPEPi/=)u;=;t25``E 0h.t)5`C=)u}WjI)e[^_ÍvU(WVSjj"jjÃSC~jjjjhc4ƃui4j/VÃufE-CS}Wu CuCtE+=)tVh.5dnp }tjURht4WVE jWV7 VKj~j9uWjVjuhw4K Ke[^_ÉUPSU 1ۋEh4E PMQ2 EU v2h4Krh4O}h4‹E PEE ph4uP}2h4y5dn5pnjP]SE X EE p h4th45dnu}uE p h4]ÐUSh5fu =Kuh 5hI5>]ÍvU}7hN5E PUR uE 0h]5{KMvE phw5u2=Ku&=t h55E ph5U}7hN5E PUR1 uE 0h]5KMvE ph5Tu2=Ku&=t h5E ph5U}7h5E PUR uE 0h6cKvu uh6XÉU}7h6E PURQ uE 0h6Kvu uh96ÉU WVSuPK} 1эYEpP1э\ ;u }]E C0P1э\ F;u |Pƒuvjt[^_ÉU}h?6E PUR t}4hD6E PUR uE 0hN6KE pphh6ÍvUSE p}uy66P]ÉUSE p}u66P]ÉUSE p}u66PA]ÉU=:tjL8=:tjU=:tMh6@tP@:Pj=;u ÐU VSUE =`u =;t;PRh6h VVÃtFSVIS:PRh65dnU5pnh Pu11nt N%[^ÉUuh65hnjSvUVSu=tSV9CÃDt#PVh6 t SNSL1t3t CPNS,e[^ÍvUWVS]u ~eEEx|K|1Džt)ttP6|P Exh6*ƒRh4h[^_ÍvU=;u j5=:t @L @Lj5jhvUS}7h6E PUR uE 0h6KiE pTEu&h6|5dn!UK0v}u h 7vUz u'h7=5dnKvjhtKhjj4 Uz t;=:u2h675dnmjj4SjNKoUz tE PEHPB ЃUBtjUBЃ=:t@L @Lj3Sj]ÉU=K%KPoPhE7KKU=L%LP;Ph`7LKUVS]u u  :h7 :KR :P :УKjvhK0 Ku pjvhp e[^ÍvUWVS~1p=pt F<0u]Kv11Ҁ=Kt1v):Ku9}pA vBKu҅uACu~e[^_ÉUSEu$;h7;K7h7E PUR uE 0h7KK}v;Kj 5$:Ã=;tC; t$:j SÃh5$:h; C; thSh*]ÐUWVS]];1E}}| |Iy}}?v|]$t\umF8twv~0~ZF:VtQύ }9]\)C]}}t^|8|t E}u}]<F8|tE}t$]tC]tFA}u}?t ]E}}*=*vE[t2$f\[~ZF]IF|$VlnDPtvF>0u$U:N}BG}:u8 <]<T)܍}|;9 v]BC]|;9u|,]\uF$u{VlnDPtkF0uU:tkv]BC]:uS<|}<8t;T(܍]];t,}BG}]|;ut] FC]t ,Ouh7EN}t.Ft܍v]t\u~tFFu뷉F<,E<]N7vVlnDPthF>0uU:tc}BG}:uN <]<t:T)܍}|;9t(v]BC]|;9u v] C]F>i}=tEEp[^_ÉU=%PPh7tKU=:%:PPh7@:KUh7u,=Ku =t h8h*8wÐU}th@8,vjj jE pwTjh`8Ph8ÐUh",#ÐUWVS=u h8]v}.h8E PMQ uE 0h8R,=`t h 99jE pP uEKh`9KvNKD@4(tK5pnÃt؈< u;48t~tF(uvt(5pnHà u5pn3 uh9!Ke[^_ÍvU=d%dPOPh9dKU}7h9E PUR uE 0h9KvE ph9 ÉUS}7h9E PUR uE 0h9OK=)u E ph/ uOEPEPEPEPEPEPh/h@ uuuuuuE ph9h@h.]ÉUE p}~ ::P ÍvUS] h.jSutssh :N]ÐUWVSDž(Dž$}*htFE PMQ<ƒ uE 0hFhvDž,,;}4vj SE p t,,; |ԋ,;u"E phFK.vDž ) 1ҋ, f5!)ff ) f%)ff $) f#)")  !)  ) ') &) %)  $) ˋ 1I8ǃ$Ff7|vf7GpviGaffORffG ,;k40lnDB t CDB u $t\CC lnDAtY1CEDQtv<|zCDQuK9|iE tVM |8{iuFDž$C(;E}3M 4Vd(M <1ҍtF;t C„PQ]E7Dƃ uhFx5KuhF~ t&=:uhFCK=th )hFV tW0҃Vt4FЃ=:t~t5dnj Ph )6QPhDNj0M}  ,9t C9$t((;EV[^_ÐUWVS]1hS3tfhSsvSǃu)Sh G5hn(jKfGfW ~ G GR0h¿ h7h . ) jjP9E }h*G腼KGE fGx:Ƌ5kPh6G5hn:j!Gw hG0 5-PhSG5dnMQӻjjPrE }$h*G辻KvhaGAjhMQ %EEPhMQ耾 }hnG_KEjEPjjMQ} hG!hGMQ萺 hGMQ}@= tuhG5hn.v=t5)hGgj ~1 t P薽@t P脽K=EjEPj jMQ*}=)t hG@) MQ1e[^_ÐUlWVSEEEEEPEPEPEPjDƒ}K1U]{ƅu耼Pzƒt2tVEPhG< vEPhG&5pnjOSu1D }uu]UvRhG_EuTUuhG蟺ERhH0Eu%Eh HpEPhHE }thH5hnƸ1v}uUtRhH=;t0p )$inif$)tjEP>PuEvE9U}0E-H1ҍvuׁtE9]|޸e[^_ÐUh8H諺5dnP`j=Xjtjh@rÉUWVSu`j=)t\h:HV} jVh@H uhFH2WV5dn_ h8H5dn跷=@uh`HAK1hjtÍ} WV5@hH5@5@W H%P-ƃ=`jt tjӃSje[^_ÐUWVSEE1E hjĶEKE1E@5 Ã5 Sh"v5 蝺ShhhH5@5@%TFuF}j8=thH?5dnK tR~D}5u>~9=@Lt!t uu5)hH۷5dnS lnDXtKDCУKu=Ku~ulnDXtu! t)t UBU Uu-u}t KE}u]}?s UBU5 à  ~$}5u5dnj 5dn聴}t8K;Et.}EURjAK1kvU}1t URj=Kt }u j6=`jt}t }tjUҋEЍe[^_UE EE@Pjjuj ÐU)`jhI׵5dn|jh谲U WVSEEE=t9}t3} tM 9-tQh2Iw}tMQh=I`=;tMQM QMQ\h9t jPӾEEEDžGjhtڃ=tj=uPj|PPjEtEPjGEEPj hLj EM uAupnEM 9|uPjj EhG] CSղEEuSrEPj跱EPj QvEhGM QµEEu= 0PM QhKI5hn$EPjYKEEP踰EPRj |E%=t-M QhZI5dn轰EPjEP虳뎍vt3EPjаEtEPj 軰K*jhQTjuqItuvIjPEP }50詰PM QhKI5hnTj5Tjh{It TjmTjDžI}tMQMQhI vMQhIt>EPj藯EtEPj 肯EEPEPEEjP9jj 0EkbY蟯1tEEtVSEPIP0ǃ ~)ۃ=)t55dnj#7EEUE9}5dn脮=,:t=UE9|3EPhI谰5dnU E(EUE9}h tQEP薭P譲ƃ =)t?E~8E=5dnj#y5dnj i5dn˭=,:tEPhI5dn覭 }$*0PM QhKI5hn. =)t>UE9|25dnj#Ѱ5dn3EE=)uă=,:t@UE9|6EPhIK5dn vE(EUE9}EP誫@EPj HE@EEPV4E@EEPƃ=)t8UE9}5dnj#5dnj 5dnE=,:tEPhI{5dn EPt$蘬0aPM QhKI5hn蜫EPtd8 t hIeEjxS蝮Et EPEЃEP.jEPjlEtEPj WESvjxP2EPj'EtEPj =Pj|P蓪PjEt EP膭jKEtEt EPEЃE~xPPEPhIh[^_ÍvU)`jhI賬5dnXjh茩UWVSEEEEuJ%EEtF=t=}t7E tE 8-tE Ph2I"}tMQh=I =;tEtMQE PMQ; EEE1=Lu E%Ejh褪tI=tj==uPj|P貨PjEhpjEU uB^E 8|RjE P脩j/E P讬7t% t PPE PhKI5hn-5tjtE JPƃt/})Ԩ0蝨PE PhKI5hnاv=:uX袨Ã; uChE P譨}.3OPE PhKI5hn芧EPj迧=:tBJ8 u8E PE E u"Z=:tE PE E t:Eu=t!jjvh9t jPK[tEPj(K1jhl=Et TjtPh{I}t MQMQhI tMQhIhG: EEU uBudnEE 8|uHjj SEhGE @PAEEuE @Pڥ^ENvMQE P7EEu*蕦0^PE PhKI5hn虥 EEP@EPRj菧 |}uE 9EvM$t P2u藦$uhJ vE jxP6Tjt jPEPxP *1S5$EP@P'ƃ 9E؉E܃=)tE9tjEPZh hmL uOjh@舕hXj‰UEPEPhIƒtEPjjjjE@EE PEPhIƒuOXjjjjEPj聓jXjEPE PhuL辕2jjOXjuJt"=;uj uJu=;t j=uLEuOE PEPhIƒ zj=cjKTj==;%P=uREuBE PEPhIDƒ t&jc=jv=t j=;%P=l 15 [5 Dƒ3j V‰UE1E} hLC=\jt Kj>j|ju=;t jfj\=\jt KEPj'\[^_UWVS] 1ލv5 q5 \3jV Ã} hLjKjqtjt[^_ÍvU WVS}j/W耔EE1tjtvJRƃt/}9̐0蕐PWhKI5hnӏ1hLb1vWh͔1IMƁ.ˁuRE}dtEC<9uE0Ejheƃ|}0uS.uC1ˆSK몸e[^_ÍvU WVShhhhH|Pnjj|P5@蘎R͒ƒ$t hL詎hhL5@衎5@ 15 65 ƒ;}t+EPEPƒ;j Wƒ,} hL=\jt Kj}tVEP蔍ÃEP胍t)h |PEP[Rpƒ ju=K(u jjl[^_U\uVSuCfhS ڃ=uS` vDƅUP^Vz=u"t5 15u [^ÐUEUMPuQtu AuAuhLQ'JQUSu9t]ÉUWVS M M5MM9s6v~;}s"36?~;]r;ur͋M e[^_UXWVS}5;~;5j~C PCPuPuӊ<-ẗ́tuhL5V=1e[^_ÍvUWVS}] $GC?*tdv[1ҾCt7]u u*-u9C9 9uBCuͅutYK{v;uFO?t>SWQuG?u&%95 v(1e[^_ÉUWVSu] 1҉эT U=9}SU~DM9B+}= DSVË\e[^_ÐUU;r D%MÉUWVSu} VuE;~u 7PuSt*u CuCt P׃Cuue[^_ÍvUVS]5jVet{u  fe[^ÍvUU1Ɉ<v <v_uÉUE< %UMU :tB9uv1UU1AuÉUU1AuÉUSE8tÉ3蝅;u]ÐUSE8tÉ3u;u]ÐUWVS]u 1҉эT R蟂ǃu h7MlSWBVW訃e[^_ÉUWVS}WPPƃu h7M1ۃ?tC:ue[^_ÐUWVS]SPEu h7M赯1;tu3聃G;uUЍe[^_UE8t@8uUWS]S跃ƒtR1эL ; r  RS1e[_UWVS1,:hbMhfM!uhM5hnjCv@:`dj/E 0dƒuE 0rMu dhM<`nEHEE E vE 8-E PxwX$M :)]TXkL`@4d(PhM5dnd~j B:vEHEE E E;5pn}PF;t;L :藂…t R{Ãu荀P~Ãt!hsS E\kE~Fjh ;*tj,hj}hj }E PE@Pjh ;~؅thji}hj ]}SUjh ;|U=:te@t)jP|P~5@@ Pj| jP}5Pj~|Pj :j=:t<@t)jP#|P}5@?@ :@Lj{ÐUWS}]5dnj HWh ) )?t W>1уdQ< uS<u4hN2~ ,5pnƒ ܍EPEPÃ}3 ǃuh2N uhFN t=:uhXN}UW t Su҃Wt uGЃ=:tt5dnj~ u^=;thN"{ǃ=;u05pnhh )| )Z`Ghjzhj ze[_UWVSE1Eb btWUU]AU8Eu}tFCUA8t}u+E;E~ Eu;EuGu E ve[^_ÍvUWVS} 1 : )`@:DLF&uE0t$: e[^_UWVS1 :=`}!t$uRDLtt2BDLy=:9!u `kbkDL $: t  uADLttDLDL $: t] tW tR"t \u AvA!AC͐t*AC뻍vt"uA몉AC吅tC` :tE5vDLtt DLDL$:1e[^_ÉU(WVSuEhN6zbiE؍@ ՘b9s"Ή;1I;M~M9rEePș}EuEE؋ULș}EE9EwEbvEE9EU҉UEE@U‹;tZ=;t{ tWhNXy;v11t'v5dnj ozF;1I9r܋UUӡi@Řb9rhNxI;1эy;}}5dnj z;}|UUEE9E EEU9UTvE E 8WÃu WhN vuWhNYxs3j hNCxNe[^_ÐU WVSDž`h5Ouƒu:ORhv5ƒ< u {tC(ú(u%hPvhh Q5hnl …ta t\Ov…CvhO5hnkhOhO5hnkh P5hnk>v5腲1???Local directory now %s usage: %s remote-file DELE %smdeletefrom-nameto-name%s from-name to-name RNFR %sRNTO %susage: %s remote-directory local-file LIST-output to local-file:usage: %s remote-files local-file SHELL/bin/shsh-cTry again laterusernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed. PWDPWD command not recognized, trying XPWD XPWDdirectory-nameusage: %s directory-name MKD %sMKD command not recognized, trying XMKD XMKD %sRMD %sRMD command not recognized, trying XRMD XRMD %scommand line to sendusage: %s line-to-send arguments to SITE commandSITE modefile-nameusage: %s mode file-name SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUIT%s %s? ftp: %s %s: %s Account:commandusage: %s command ?Ambiguous command ?Invalid command ?Invalid proxy command Not connected Case mapping %s. Carriage Return stripping %s. Ntrans off. Nmap off. mapoutUsage: %s [mapin mapout] nmap: unbalanced brackets Store unique %s. Receive unique %s. CDUPCDUP command not recognized, trying XCUP XCUPrestart: offset not specified execute get, put or append to initiate transferrestarting at %ld. %s Limit of 16 macros have already been defined macro nameUsage: %s macro_name Enter macro line by line, terminating it with a null line macdef:end of file encountered Macro not defined - 4k buffer exceeded Passive mode %s. filenameusage: %s filename SIZE %s%s %02d/%02d/%04d %02d:%02d:%02d GMT STAT %sSTATLocal file "%s" is newer than remote file "%s" send account command to remote serverappend to a fileset ascii transfer typebeep when command completedset binary transfer typetoggle mget upper/lower case id mappingchange remote working directorychange remote working directory to parent directorychange file permissions of remote fileconnect to remote tftptoggle carriage return stripping on ascii getsdelete remote filetoggle/set debugging modelist contents of remote directoryterminate ftp sessionexecute macroset file transfer formattoggle metacharacter expansion of local file namestoggle printing `#' for each buffer transferredprint local help informationget (set) idle timer on remote sidechange local working directorylist contents of remote directorydefine a macrodelete multiple fileslist contents of multiple remote directoriesget multiple filesmake directory on the remote machinelist contents of multiple remote directoriesshow last modification time of remote fileset file transfer modesend multiple filesget file if remote file is newer than local file nlist contents of remote directoryset templates for default file name mappingset translation table for default file name mappingenter passive transfer modetoggle use of PORT cmd for each data connectionforce interactive prompting on multiple commandsissue command on alternate connectionprint working directory on remote machineterminate ftp session and exitsend arbitrary ftp commandreceive fileget file restarting at end of local fileget help from remote serverrename filerestart file transfer at bytecountremove directory on the remote machineshow status of remote machinetoggle store unique for local filesclear queued command repliessend one filesend site specific command to remote server Try "rhelp site" or "site help" for more informationescape to the shellshow size of remote fileshow current statusset file transfer structuretoggle store unique on remote machineshow remote system typeset tenex file transfer typetoggle printing byte counter during transferstoggle packet tracingset file transfer typeget (set) umask on remote sidesend new user informationtoggle verbose mode?verboseumaskusertypetraceticktenexsuniquesystemstructstatussizesitesendruniquermdirrestartresetrenamerhelprstatusregetrecvquotequitpwdputsendportproxypassivepromptopenntransnlistnmapnewermputmodtimemodemlsmkdirmgetmdirmdeletemacdeflslcdimageidlehelphashglobgetformexitdisconnectdirdebugdeletecrclosechmodcdupcdcasebyebinarybellasciiappendaccount$!macro nameUsage: %s macro_name. '%s' macro not found. ?Ambiguous command ?Invalid command Not connected. %s ftp: %s: ftp: socketftp: connect to address %s: Trying %s... ftp: connectftp: getsocknameftp: setsockopt TOS (ignored)rwftp: fdopen failed. Connected to %s. ftp: setsockoptName (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin failed. init$init ---> PASS PASS XXXXNo control connection for command QUIT%c%c%c421 Service not available, remote server has closed connection %s: send aborted waiting for remote to finish abort local: %s remote: %s -local: %s: %s %s: not a plain file. STORAPPEREST %ldr+w%s %s%s Bytes transferred: %ld Bytes transferred: %ld netoutsent receive aborted waiting for remote to finish abort RETR.mallocnetin%s: short write WARNING! %d bare linefeeds received in ASCII mode File may not have transferred correctly. receivedftp: setsockopt (ignored)PASVPassive mode refused. %ld,%ld,%ld,%ld,%ld,%ldPassive mode address scan failure. Shouldn't happen! ftp: setsockopt (reuse address)ftp: bindftp: listenPORT %d,%d,%d,%d,%d,%dftp: accept%ld bytes %s in %.3g secs (%.2g Kbytes/sec) .AP?STOUproxy server does not support third party transfers. No primary connection PORT %slocal: %s remote: %s abortresetrunique: can't find unique file name. %cABOR `{[*?{{}Unknown user name after ~./Bad directory componentsArguments too longPathname too longOut of memory/tcpftpftp: ftp/tcp: unknown service pftpTERMftp: %c: unknown option ,, ,,,,,,,,,,ftp> sorry, input line too long ?Ambiguous command ?Invalid command Not connected. Commands may be abbreviated. Commands are: %s ?Ambiguous help command %s ?Invalid help command %s %-*s %s macdefmachineaccountpasswdpasswordlogindefaultHOME.%s/.netrcrError: `password' must follow `login' in .netrc anonymousError - .netrc file not correct permissions. Remove password or correct mode (should be 600). Remove account or correct mode (should be 600). Missing macdef name argument. Limit of 16 macros have already been defined Macro definition missing null line terminator. 4K macro buffer exceeded Unknown .netrc keyword %s p&X"h"&&t""&p&$$&&$$&p&x&&&&&&& l$Id: cmds.c,v 1.19 1997/06/08 20:07:19 dholland Exp $,-T,-,-,,,, L-$Id: cmdtab.c,v 1.6 1997/04/05 22:26:22 dholland Exp $qFcCoFx<gF`:t`F:LZF:̡UF:زNF:JF@AEF;BF@;=F`;7F;`1Fb<.F;L'F<!F"<F@<Fb< F@AF< FzA\E<E<@E=E@=E:E=E=E=E=\E>E->E@>E>E>E>E?E ?E?E`?E?E;LE@E@8|E@dsE@@ToEBLkEADfE@A`E_A[EzA\UEADMEgBGEAT@EA:EB2EBT,E@B$$EBEBLECEwClECEC,ECDCDCܡD DDND DdDXDDDDDD D=J$Id: domacro.c,v 1.4 1996/08/14 23:27:28 dholland Exp $$Id: ftp.c,v 1.15 1997/03/21 02:02:05 dholland Exp $Package: netkit-ftp-0.10$Id: glob.c,v 1.5 1996/08/14 23:27:28 dholland Exp $L@(#) Copyright (c) 1985, 1989 Regents of the University of California. All rights reserved. $Id: main.c,v 1.13 1997/03/21 02:06:35 dholland Exp $`M!$$Id: ruserpass.c,v 1.5 1997/04/06 00:00:24 dholland Exp $-O'OOOOO Omړ *:JZjzʔڔ *:JZjzʕڕ *:JZjzʖږ *:JZjzʗڗ *:JZjzʘژ *:JZjzʙr  $+(`p  ld0o4ooVGCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)01.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.bss.comment.note# 1((H7 pp?`` GoVVTo440c ddl ll(u  ~/ēԙP$+$@+@H& a\ klllm`n` `<,ELFd4,4 (444  /lib/ld-linux.so.2GNU     Ć"%Ԇ),(3+?"D0U4\hT$p["8T@"d,D"4"t"$"@"4H"D:"__gmon_start__libc.so.6textdomainprintfstdoutgetopt_longputs_nl_msg_cat_cntroptarg__dcgettextfprintf__deregister_frame_infooptindreadfclosesetlocalestderrerrorfwrite__errno_locationexitbindtextdomain_IO_stdin_used__libc_start_mainopen__register_frame_infocloseGLIBC_2.1GLIBC_2.0ii  ii *(,048 8<@ DHLP TX\`dhlp tx| US[/!Xty ]50%4%8h%<h%@h%Dh%Hh %Lh(%Ph0%Th8p%Xh@`%\hHP%`hP@%dhX0%hh` %lhh%php%thx%xh%|h%h1^PTRh\hQVh/U=u8P С 8u鸔t hÉUÍvU4th<hAÍvUÐUS]tU5Tt 09Xt#jh`j ‰T0XR5, 5\t 09`t#jhj ‰\0`R.dt 09ht#jhjF ‰d0hRlt 09pt#jhj ‰l0pRX%PUSM1 \BABЃ v9u]ÉUWS]1эQtBLktbt 0mt( De[_ÉUu=t PhUWVSuvhWM Qà } MQh0jxtp9~5(SjWuLtt 09xt#jh"jg ‰t0xR0js )T1[^_ÍvUWVSuvhW] S }$]ShB0j v19}B< uNt9|5(RjWuL|t 09t#jh"jh ‰|0R0jt 11[^_UMU E=u PRQ PRQÉUWVS]} uCudt 09t#jh0j ‰0Ӄ=t SWWjSWZjShƃ|/=t S(WVS)V}uSh0j\e[^_ÍvUWVS] 1Ehj?h?hQphQ}S:-BЃ 1v4StpЍJKBЃ vC8SUw^$v}qeaYMPt 09t#jh[j ‰0RjjjSJKz(CMntKct vqv54 54;ƃuk54t 09t#jh|j ‰0Rjj jjhhuSMQd=thhhjd=t j0u ~tuEH98} 8;Eu8Vh.E8 V4 E8H 8;E|܃=t$j}h.0j 5(\uLt 09t#jh"j_ ‰0R0jk }%P6UWVS} u k8uVWUR;à |؍e[^_US=tЃ;u]ÍvUÐUS[]HcBn<q5q-v( versionhelpverbosesilentquietlinesbytesTry `%s --help' for more information. Usage: %s [OPTION]... [FILE]... Print first 10 lines of each FILE to standard output. With more than one FILE, precede each with a header giving the file name. With no FILE, or when FILE is -, read standard input. -c, --bytes=SIZE print first SIZE bytes -n, --lines=NUMBER print first NUMBER lines instead of first 10 -q, --quiet, --silent never print headers giving file names -v, --verbose always print headers giving file names --help display this help and exit --version output version information and exit SIZE may have a multiplier suffix: b for 512, k for 1K, m for 1 Meg. If -VALUE is used as first OPTION, read -c VALUE when one of multipliers bkm follows concatenated, else read -n VALUE. Report bugs to textutils-bugs@gnu.ai.mit.edu %s==> %s <== %swrite error-standard input/usr/share/localetextutilsunrecognized option `-%c'c:n:qvinvalid number `%s'1.22GNU textutilshead (%s) %s ԍ((((((( ((((((( (:JZjzʆچ *:JZ  \(  ,\,0oooĄGCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)01.0101.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.bss.comment.note# 1((7 ?4GoĄ6To0c ,,l 44(u \\ ~/$$@dd \\ $$,,\(((MELF44 (444تت,Xddd /lib/ld-linux.so.2GNU     )!+-̆"3:IH\"O\$W"o vl;;g"|<," |"Llyď܆ <gLt"__gmon_start__libc.so.6printfgetopt_longfgetsoptarggetdomainnamerindexfprintf__deregister_frame_infooptindsethostnamesetdomainnameindexinet_ntoaherrorgethostbynamegethostnamefclosestderr__errno_locationexitfopen_IO_stdin_used__libc_start_mainstrchr__register_frame_infoGLIBC_2.1GLIBC_2.0ii )ii 3`    $ ( ,048 <@DHLPTX\US[$`ty6 ]5%% h%h%h%h%h % h(%$h0%(h8p%,h@`%0hHP%4hP@%8hX0%<h` %@hh%Dhp%Hhx%Lh%Ph%Th%Xh%\h1^PTRhhQVh/U=u8PܪСܪ8u鸬t hÉUÍvULthh1ÍvUÐUWS]=,tSh 5 1IQSƒtEt t+5(h@v5(hn5 je[_ÐUWS]=,tSh5{ 1IQSƒtEtt t+5(hv5(hn5 je[_ÐUWVS]} =,tShА5 Sƃu5(j=,t_6h5^Ph5 u^ 0Ph5auj.6/udtvWwn$80Fh+F8u&v0F7Ph+ F8uh/@P t6h1me[^_ÐU@WVS]} hSƃtu]Uj St=,tSh5p }#t t t vSSVj@S uV#vS5(h5je[^_U55h5jUh5h 5h5h5 h 5h5vh5fh 5V h`5Ch53h5#h 5 h`5h5h 5h5 h5h@5jUXWVSEE1ۍEEljEj/E 0h…tj/M 1SBvE (ֿ t&ֿ tֿuֿuuLW:w=$3M&E, VhphM QEP>ǃu tkWtD}u M9 }=5(h5%h 5h5jEd}tjEP% ;U}M 4jAEP=,tMQh5 }uEPtMQEPnl}tjMQY ;U}E 4@jAMQ=,tEPhՙ5 MQh1jUS=tЃ;u]ÍvUÐUS[k]net-tools 1.52hostname 1.98 (1998-02-27)Setting hostname to `%s' %s: you must be root to change the host name %s: name too long Setting domainname to `%s' %s: you must be root to change the domain name Resolving `%s' ... Result: h_name=`%s' Result: h_aliases=`%s' Result: h_addr_list=`%s' %s %s ;xc|r>> %s %s: can't open `%s' %s %s Usage: hostname [-v] {hostname|-F file} set hostname (from file) domainname [-v] {nisdomain|-F file} set NIS domainname (from file) hostname [-v] [-d|-f|-s|-a|-i|-y|-n] display formatted name hostname [-v] display hostname hostname -V|--version|-h|--help print info and exit dnsdomainname=hostname -d, {yp,nis,}domainname=hostname -y -s, --short short host name -a, --alias alias names -i, --ip-address addresses for the hostname -f, --fqdn, --long long host name (FQDN) -d, --domain DNS domain name -y, --yp, --nis NIS/YP domainname -F, --file read hostname or NIS domainname from given file This comand can read or set the hostname or the NIS domainname. You can also read the DNS domain or the FQDN (fully qualified domain name). Unless you are using bind or NIS for host lookups you can change the FQDN (Fully Qualified Domain Name) and the DNS domain name (which is part of the FQDN) in the /etc/hosts file. d}Fxfshnfhs`VXvRaGiCy@yypnisip-addressaliasverboseversionshortlonghelpfqdnfiledomainypdomainnamedomainnamenisdomainnamednsdomainnameadfF:h?isVvyn%s: You can't change the DNS domain name with this command Unless you are using bind or NIS for host lookups you can change the DNS domain name (which is part of the FQDN) in the /etc/hosts file. gethostname()=`%s' getdomainname()=`%s' dBRbr†҆"2BRbr  ( ) T4 ooo΄GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)01.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.bss.comment.note# 1((7 ?=Go΄6To0c 44l <<u TT ~/,,` تddd,nnrxELFT44 (444  /lib/ld-linux.so.2GNUMFyH49?t%vu$'m`58p QWbVa6oK1G  +gNjEw:_!{,h]YqX|zD>x@L i)2*.(\AT"s^ZeOr IRSP3#-~}nUdcB0f7C&;J/l=k <[ #D!*  5 >="DėJD/"Q)Xd_$;eryD)$/"4+;"lԘ$br$$"X ě@="(/"/h 8S"?3"DU:"\tc$7"i="p2"%t  Tm"0 Tę;"$7"ԗ;Ĝ'"d=" $)T #TA,;34"KԚ7"QpW4#"\7"b3i3"p`"w"~="BDt7"Z"j"J"ĝĘ/"Ět;"%DRt'ԛ0" tA4"4%d.bB)IdR7"V4"]f$nuTh$y"  d7"T"4 ԙ;"x  C"D;"D "+:Ԝ%AtS4"[gb"hdl"qԝ`"x;"~`Dt"7"dOF"Ty"I__gmon_start__libc.so.6setgrentstrcpytextdomain__divdi3ioctlchowngetgidprintfstdoututime__strtoull_internalstrerrorgeteuidgetopt_longmunmap_nl_domain_bindingsgetgrgid__ctype_bgetenv__rawmemchr__strtol_internalbsearchqsortfscanffgetserror_at_linememcpyexeclreadlinkgetuiddgettextsystemfeof_nl_msg_cat_cntrmallocoptargrmdirlchown__strtoul_internalerror_message_countfflushcreat64__xstat64__umoddi3strncasecmp__udivdi3abortchmoderror_print_prognamepiperenamecallocwritefprintfstrcatdcgettext__stpcpymkfifo__deregister_frame_infochdirstdinwaitumaskmktimeferrorsetgidsignalread__argz_countstrncmpstrncpyunlinkstrcasecmprealloc__strdupreaddir64_IO_getcforkexeclpsymlinklocaltimememsetfnmatchopen64timeopendir__assert_fail__xmknod_nl_default_dirnamestrcmpgetpwuiddupgetcwdgetpwnamsprintffclosesetlocalestderrmmap64error__lxstat64fsyncfputcfwrite__fxstat64accessgettext__argz_stringify__errno_locationlinkexitbindtextdomaingetgrnamerror_one_per_line_IO_putc_IO_stdin_usedgmtime__libc_start_mainlseek64strchrfputsclosedirsetuidmkdir__ctype_tolower__register_frame_infoclosevfprintffreefopen64ftruncate64GLIBC_2.1GLIBC_2.0ii ii `~d hclp>t%}r4B y"j $:(6,T0R4[8<7@ODH@LDP*TIXd\X` dbh\l,pntCx|!1k;$3<o0VAm+PĔ=Ȕz̔Д ԔؔܔxGhgwK8 Ua fML& $({,Q0W4J8_<p@5DvHtLPFTX \^`Sd.hYlHp]t(x`|iN|E'?US[ËthO{]5%%h%h%h%h%h %h(% h0%h8p%h@`%hHP%hP@% hX0%$h` %(hh%,hp%0hx%4h%8h%<h%@h%Dh%Hh%Lh%Php%Th`%XhP%\h@%`h0%dh %hh%lh%ph%th%xh%|h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%Ĕh%Ȕh%̔h%Дhp%Ԕh`%ؔhP%ܔh@%h0%h %h%h%h%h%h%h%h%h %h(% h0%h8p%h@`%hHP%hP@% hX0%$h` %(hh%,hp%0hx%4h%8h%<h%@h%Dh%Hh%Lh%Php%Th`%XhP%\h@%`h0%dh %hh%lh%ph%th%xh%|h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX01^PTRhhTQVhU=u8PС8u4t hԓÉUÍvUDthxhԓaÍvUÐUPTX\ÍvUSt 9t#jhj& ‰R5hJ PTSQh5h,h5h]ÍvU ) ĚU=Кt0К ‰ÉU;u'=Кu3;u К1ÍvUM9rv9s;vÉU+EÍvUS]SSt 9t#jhj^% ‰R0j@t 9t#jh j% ‰Rjj@]ÐUVSu] 9ZSW'8 St 9t#jhFj$ ‰R0j@t 9Ėt#jh jO$ ‰ĖRjj?V9uȖt 9̖t#jhaj# ‰Ȗ̖R90j`?Жt 9Ԗt#jh j# ‰ЖԖRjj?Ve[^U`EPuj|E%=t1ÐUVS1ۋФ +vФ9tS Hp%=u7~)RPAPJ)RPQB ƅ}؅ue[^ÉUWVS]Sؖt 9ܖt#jh~j~" ‰ؖܖR0j=t 9t#jh j5" ‰Rjj=Țt 9t#jhj! ‰R!0jH=t 9t#jh j! ‰Rjj==Ț~Cuvt 9t#jhj+! ‰t 9t#jhj  ‰Rjus' uB=u+j:1r‰t;v z/0=tj0h0y=t0t 9 t#jhj ‰ RSjO;t 9t#jh j ‰Rjj ;t 9t#jhjS ‰Rj5@j<PP5< t 9$t#jhj ‰ $R90j`:(t 9,t#jh j ‰(,Rjj:uV0t 94t#jh~jP ‰04R0j98t 9<t#jh j ‰8<Rjjx9Å@t 9Dt#jhj ‰@DR0j9Ht 9Lt#jh jh ‰HLRjj8Pt 9Tt#jh j ‰PTRjv uUj<PP5<Xt 9\t#jhj ‰X\R0j!8`t 9dt#jh jl ‰`dRjj7ht 9lt#jh"j% ‰hlpt 9tt#jh3j ‰ptRjuv! uBug=uCj:1b‰t+9v z/t5HhjAPh0=0xt 9|t#jhj ‰x|R;0jb6t 9t#jh j ‰Rjj6Ф1159s/)=wPVjWà ~ ޡФ9rӅt 9t#jh`j ‰R_0j5t 9t#jh j ‰RjjB5t#^áФ9SYt3Ф)PjR ;Фt S5e[^_UWVS]S*t 9t#jh~j ‰R?0jf4t 9t#jh j ‰Rjj"4*Țt 9t#jhjX ‰R0j3t 9t#jh j ‰Rjj3=Ț~ Es.At 9t#jhj ‰t 9ėt#jhj_ ‰ėRjsOuuB=u+j:3‰t;v z/0\hj0j 0ȗt 9̗t#jhj~ ‰ȗ̗R0j1Зt 9ԗt#jh j5 ‰З      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPԗRjj1ؗt 9ܗt#jhj ‰ؗܗRj5jh<PPX5<t 9t#jhj ‰R0j0t 9t#jh jA ‰Rjj0uVt 9t#jh~j ‰R+0jR0t 9t#jh j ‰Rjj0Åt 9t#jhjG ‰R0j/t 9 t#jh j ‰ Rjjo/t 9t#jhj ‰Rjuvjh<PP 5<t 9t#jhjF ‰R0j. t 9$t#jh j ‰ $Rjjn.(t 9,t#jh"j ‰(,0t 94t#jhjv ‰04RjvfuuBujv=uCj:3‰t+9v z/t5HhjPhj0u =08t 9<t#jhj ‰8<R0j,@t 9Dt#jh j; ‰@DRjj,̚~5Ф5P5Ф5PfN ƅ} 뼉0 MvSMQj/ƃ Ht 9Lt#jhjg ‰HLR0j+Pt 9Tt#jh j ‰PTRjj+9tV)SXt 9\t#jh@j ‰X\RjjA+])z5e[^_UWS]jS5` ui=ܤu1[v=`1уQQMǃ5`W8hmWzjSWQƒW؍e[_ÐUhWVSu1ۃ=t hd=Ф`t 9dt#jh|j ‰`dRjj)ht 9lt#jh jB ‰hlRjj)=lpt 9tt#jhj  ‰ptRjj_)xt 9|t#jh j  ‰x|Rjj) =uhK=ܤt.ФP‰t05Ф5t 9t#jhj  ‰Rjj=(t 9t#jh j  ‰Rjj' ‰t 5 =ܤ=t 9t#jhj  ‰Rjjd't 9t#jh j  ‰Rjj '=<=ܤt 9t#jh@jN  ‰Rjj&t 9t#jh j  ‰Rjj{&=t 9t#jhj  ‰Rjj'&t 9t#jh jr  ‰Rjj%tr t vkt 9Ęt#jhj  ‰ĘRjjp%Șt 9̘t#jh j  ‰Ș̘Rjj,%xӅuzEσux=Иt 9Ԙt#jhj  ‰ИԘRjj$ؘt 9ܘt#jh j ‰ؘܘRjj<$tr t1 hvh=t_=j:2 ‰z89kz/a5HhjBW\torMv=uGj:2‰t/89v$z/t5HhjWOvhj=tj2=uIj:0‰t,89v!z/t5HhjAW}vh0od=uCj:2‰t+89v z/t5HhjBWohjB09 ‰|!h`Rjn 8t0t 9t#jh#j ‰RWj!t 9t#jh j ‰RjjE!1E2}1IMwS:2)…tQuMW3)ƒv;u7W4)ƒv%u!W5)MQ2…tI=EEPh2j[ u.p%= uE9uUĸ9Pu=3p%=u"`dlor ==`+Dž5`t 9t#jh@j ‰Rjjt 9t#jh j ‰RjjCW.35`Wt 9t#jhjs ‰Rjjt 9 t#jh j/ ‰ Rjjv=`=1=ܤt5`h5L v5`55h 萷ƀVj PjP;5?e[^_UWVS=@twԚE@ԚuFgfffu}+U9uHVt 9t#jhj ‰RjjnƋ t&=\9wu;5Xw1v=t ФCNjФ9t=ܤuW8v=tt PT~ X\;=Ф=ܤu9ؚܚvB:/tR5 ؚܚ[}ttt WDj%X\`t8t(8t`v1tc=155`h5Vj PjP8ƀV5< 8=`t =1҉55{ƃMj |P SQ%8j qS ؚܚ+ SQ7dd 5=<d=`t xNjФ9tWvФv=tt PTX\3ue EE M] )PR5EM]= 9}$u ];wM])  M]M]EU}}M]M] M]9}u9uw L:/uB:/tR5 ؚܚe[^_ÉUVS]0=tt,0t 9t#jhj ‰RVjY t9$jh j ‰ $,05ФS(t 9,t#jhjQ ‰(,Rjj0t 94t#jh j ‰04Rjj~e[^ÍvU,08t 9<t#jhj ‰8<R0j! Ě@t 9Dt#jh jX ‰@DRjjHt 9Lt#jh j ‰HLRjj̚̚ Pt 9Tt#jhCj ‰PTRjj*Xt 9\t#jh ju ‰X\RjjU`WVS=@t{ԚE@ԚMAgfffM}+]9uJQ `t 9dt%jh]j ‰`dQjjZ̚=t% ĚtZ;Фt SZ=ܤ tL9/u vA9/tQ5~ ؚܚ1ؚܚ 5Ф~V5APV5QW6 Ë5Ф9Dt!} 8t==ܤ Trvujj  ~5Ф5AP5Ф5Q5 Å} 4뼉5Ф9v=V=`tnWha5`W ht 9lt%jhj ‰hlQjj   =dtLW pt 9tt%jhpjM ‰ptQ5 Uv=`tI xt 9|t%jh|j ‰x|Qjj] 9 MuQWt`5 t 9t%jhjy ‰Qjj  j G|P蝛EUj qUR膛ӋEUډEUU9ؚuE9ܚu9w9URSQXQEPEURPD QUR RP( QW t 9t%jhj| ‰Qjj  (vؚ5ܚ+5j UREU;]u;utZ t 9t%jh j ‰QjjX   .=/v} =)ދ ud=dt[ ĚuN~J S t 9t%jh?j- ‰QjjФ)%|l ~ VWAPVWQL1 Å}Ѕ,0 t 9t%jh`j| ‰Qjj t 9t%jh j6 ‰Qjj),0S t 9t%jhj ‰QjjJ t 9t%jh j ‰Qjje[^_U ) Ě   ==~ PpP^}ZP5,0t 9ęt#jhj ‰ęR0j /trt svÉUVSfE]C~Shm@P Shm@P L8u2~Shm@P Shm@P ~jjjPxjjjPÉ+Ф~jVSPA9u9uvjVSP^9u9tașt 9̙t#jh j ‰ș̙Rjj  9t )PjRe[^ÍvUS=u u MuZ=p%=u<5Ф5P -~5Ф5P! ڡ=TjjjP?|RP5 tS,0Йt 9ԙt#jhbj ‰ЙԙR$0jK =t#~ PP}ZP5,0ؙt 9ܙt#jhjT ‰ؙܙR0j =Țg] vVS;Țu<U1t %Ѓ }Dt 9t&jhj ‰MvPQt 9t#jh~jQ ‰Rjjjv%=tVtRPt 9t#jhj ‰RjjV t Pzt Pht PV=ܤtP:]ÐUSh5Ãt3hhSSu>5hy0ot5hPj]ÉUSh5Ãt5hSFSpu#5h0j]UTWVS=u0=hu'=uhh}p=Ȍt 13=t~ PP肽}ZP5,0t 9t#jhj ‰R 0j4,J , l؃9u,Č=Čht$=t RhP軽v}5hj?,05t 9t#jhj ‰R5hI5h莼5jPW0 t 9 t#jh jp ‰ R5h߻TvGt 9t#jh`j ‰Rjj j聿E< j ‰Qh5 j ‰Qth5  H}q5  t 9$t%jh j* ‰ $Qm1jjLPRP{GjVSQ}o5 5PVS?r P (t 9,t%jh_j ‰(,Qٟ0jj)=ܤt$5 h;E̋UУ h(5L=ܤtjh5H聞}[5  0t 94t%jhZj ‰04Q0j7[^_ÉUS=̌u5谠hK5PfE]C ~Shm@PShm@P t8u2~Shm@P誤 Shm@Pء ~jjjP蠣jjjPğщƒ tO8t 9<t#jh!j ‰8<Rǝ0jȌvkeÃu_tZej@t 9Dt#jh!j ‰@DRjjnCv 놉Ȍ]ÐU`WVS]u ]uuuNuM )QSM Au 95p1p[^_ÍvUWVSj蜬=hKjjjStÅumSVM1р| /th#Vz1эLMXt>t6YuCPEPjjjVq1uӊÅeVc!jjjS4j2~Ãu = tHe[^_ÐU4WVS=PtEPh#ƒn=Xth MQjSƒ uxh ]Sj踏ƒ t_EPt 9t#jh#j趹 ‰R0j"= `hhh S LPDH=0%=@ty5̤9}o=t95p}^} V}L]St9jh$j͸ ‰vƋ tg95 u_ 9PuU9,uHEPt9Djh+$jS ‰0=4Iցt t`t 5Ԍv,9F   9FB9Fw4ul>/ue=܌uW܌t 9t#jh`$jo ‰Rjj 4Ft1Icv jKVVhlLPh MQT-jdVÁÝS$ Tƀƀ1P=pMQ莉ƒ]St 9t#jh$jg ‰R謉06R}1҃RHƋ,^ $N^]SFP Ԍ5Ԍ0 Dž8= LPΉ߃}  ,0 X\ tK9Q99w590 909,x`dh ]SDTTƀSDž8PMQ4~ Tƃj TP LPSQ4S`P_`d LPj T|S`dSQDž((TǎTƂDž|tWj V \SQdj W tp ((~ vDž4LPX\=uX \u 0%$=$uDž@wvj]S}@}\St 9t#jh#j蚲 ‰R߅0j=8u;h EPTu @{@Q规jTTOTQRDž$輋PP1҉1P P$0;4Uj QRtj W  [SQIF~PSN$;4$ƃ,XOSg@JMQ LPSQP@SƒI=ܤtAMQheX\  LP  E=6@ DžDž;t%1ˉuЃj T|QSQ;TSv=ܤtA]Sh\   虁PljDž99uE9v7t+PjR^~ WSP|)OQu =ܤtjh[= SEP}==Ȥtz}ut 9M u @9Et\=d]St 9t#jh@%j2 ‰Rjj`gyEPV|MMQt 9t#jhj%j ‰Ry0;.{/1vR]ƒP5ƒ1ҍT9r3ҍTBRS5PQ|j SQS`P}zƒ QzSH{= PMQX{v u3*`u4t 6=L LPh ]STT<6tIjTIP@D%P2jTQP@P7TS=pEPGvƒMQt 9 t#jh$j ‰ Rev0B]St 9t#jh%jע ‰RjjH[^_ÐU4WVS} }fE}EG™;Mu ;] W t 9t%jh%j8 ‰Qjj觽 t9$jh &j ‰ $fEUډU܍}WЙÉ֋EU ẺU]̃U];]u ;u (t 9,t%jh%jp ‰(,Qjj߼ 0t 94t%jh &j* ‰04Qjj虼 ~Whm@APzWhm@Qw *t8u6 ~Whm@AP_z Whm@Qw  ~jjjAPQyvjjjQtuEUФUEEeÉ֋UU ֋EEƋEUEUEU RPVSEԉU؋U9UE9E1ɋU9U9Eu U9Uv9uY ~)jEURPQxӃ;Mu/;]u*jEURPQtӃ;Mu ;] 8t 9<t%jh%jJ ‰8<Qjj蹺 @t 9Dt%jh &j ‰@DQjjse[^_ÍvUS=uD'؃RP}t*=t SQ]ÉUWVS1Edjv+9ƃD$&rv5 Umu>5wtM LPSQzL@5w}]$&Ht 9Lt#jh`&j' ‰HLRjj蘸 Pt 9Tt#jh&j ‰PTRjjQ pvu5ФƉ5)  ) 7 PRVq $  RjP4s jM9Uuv7ƒu(=t5u]봍B`ucXt 9\t#jh&jj ‰X\Rjj۶5Rux5 j@5#u5L=P} Ɖ +v+U щȉ)F]) M]9}u9uv EEn= =5 5L=P} Ɖ 5 t=u j]U)]} MM]9}u9uvu v9u>2]ىȉ9u9vu]] M9~E ]]e MQ]SPnM )ˉ]M Mȉ)׋])] }u j  MS辨 ge[^_ÐUjl@tpƒDjkH=t LPjHL%H?ÍvUVSu] =8tCtwL#CPVk}_L#CPV`t 9dt#jh'j轗 ‰`dRk0j)e[^UWVSu] }==tC@v@ESHEPPV8n}WVht 9lt#jh 'j ‰hlRPj0jwSV=Du =|tZssVn ssVpt 9ttyjh`'js ‰ptTssVg }]ssVxt 9|t#jh'j ‰x|Rbi0j艱u CtSVe[^_ÍvUWVSu1iEj/V 9CЃVS$X+ jxDž1Džj P3щ¡Lj  P3¡Tt ~Dž/hDžǃ B9~&UP5Atlj Q2[5Tj W2¡TLtQxgVdg ډ1у</ =8tA SttDžd=Dt5ؤ PwE7uZ=uQt 9ĝt#jh@)jw ‰ĝRjj 50S Pa  P Qȝt 9̝t#jhm)j׋ ‰ȝ̝R_0jCt;5L=PWVd: S 1SqS VW`5L=PW5L=PWVWP$v5L=Puv=ܤt@5 hw?LP 2duXНt 9ԝt#jh (j# ‰НԝRjj蔥 P8dÉDžQ9u$;vDž\SWP諨L;Qc9 }g P؝t 9ܝt#jhZ(j ‰؝ܝRb\0j艤ySV Qt 9t#jh)j蝈 ‰Rjj+RP679)Wu t=ܤtjh<= PcZà Pt 9t#jh)j複 ‰RZ0j=1C==Dt75ؤ P? Pt! P5G]Ãuƅu jv5 Vt 9t#jh)j袆 ‰RY0jv==Dt5ؤ P> P5CZà Pƒ=tOY8EP5j%Y uG @RPjY u%@9EuD9EuL9E'5= Pt 9t#jh*jI ‰RX0j赠G 1 v 1`==Dt5ؤ P== 05@=DWSPj[à PM Vt 9t#jh *j ‰R[W0j肟jh = P9\=O=Dt75ؤ PJ< Pt!50 PWÃuƅu&jh  V= Pt 9 t#jh8*j ‰ R1V0jX= 1уt& </u u܃=tV!Du5L=PWV1=0 =DuRSwSÃEUÃ;u> RPjU u%=@ Pg <.u tc|:/t\Rt 9t#jh`*j: ‰RT0j覜8=Duq0%=t]0 Pt 9t#jh*j謀 ‰Rjj=t!h  QEjh聾Ë5 WӾ‰SSDž ׋PPv=d5  t 9$t#jh*j ‰ $R5?RJ/>5 (t 9,t#jh*jq ‰(,Rjj5L=PWV.d0t 94t#jh*j  ‰04Rjj|5L=PWV-=tc:\ PR8t 9<t#jh +j~ ‰8<RjjL[^_ÐUSPt3PjCPssTSTPÅuϋ]ÐUE@ÐUSj 2j2CC؋]ÐUS]sTST]ÉUVS]uS;v2PsCSVu SRSse[^ÐUWVSu] j艻ǡ=SGW C GVϻGMOGS1Ge[^_ÍvUVSutVsgOuu1e[^ÐUUE @P@P6OUWVS]SSEu]S Tt 9Xt%jh,j| ‰TXQO0j1(O1эQcUeQFƃSV2T1р| /th,V_Q1IMSÃt [] EE[MQ04BUR5tjh,EPv}1ыUL ExU9rT}1ыUL E9r%]Ed1ыUL E9sEPV?ƃUREPR=XtxRVjN uyxPVjyP t`V \t 9`t%jh,jzz ‰\`QM0j=ȤtU9U uE9Etjh,vE%=@UVÃ{tEU uE9CuE9C uE9Cty=dtJV dt 9ht%jh,jy ‰dhQjjCEU1CEUCS ECC -u=dtJV lt 9pt%jh -j y ‰lpQjj|h -xPVcVC}ttCjh-4}u& ̤9M}=t9M} jh,EP jh!-UR }1QUREP UR(Njh#-EPsVNUR\NEPEEÃ;tvE1ˀ;u}uUR1EP|Ƌ];t1ˀ;uhHIjUR|PqL+]S荵lj|>tvACu>uURZ|PMh[^_ÐUWVSE URPUR6E=Ԥ t1EPWRKIt?utMu&-O}}1эQUcvqcdFP誴ÃURSNE|/t /@EUUp}1эy}DuLM9rvd9sFPSgÃUBREP&NSM>E URPSU|:}EuSLe[^_ÍvU|WVS=uhѳhI :/bh5Ltt 9xt#jh@-jEu ‰txRjj趐|t 9t#jh`-ju ‰|Rjjr1֋ ΁vYSRt 9t#jh-jt ‰Rjjh,RI5 5I h-RHJuWfG8X5 t 9t#jh-js ‰RvShP H =jj jQ^Hƒ̤W1ҋ| uG1҉󫋽jj jSGƒщ9u9tQt 9t#jh-jr ‰Rjj  Ѓ wGЃ vjj jW8GlDB tvGDB uvGЃ vGW(jVWShPuFƒ SGƒu#5 h-E0j?x[^_ÉUWVSh-5 GǃuI5 t 9t#jh-jNq ‰Rv5h-WC tS{tEs*&ƃtVssh.WwCVGsssh.WXCuWyFu#5 h-D0j(e[^_ÉUUE zt xuxt vPBPBÐU`WVS6= td5Ԥuh.h85Ԥ;{{{ C tMPD}@s t 9tyjh.jo ‰RsEPVjQE }^Vt 9t%jh,jTo ‰SB0j辊'vE%=@uCUMQRV 1Ԥޅt@uhUjPVS&ԤÃt Cu= t e[^_U WVSEE UEPDƃuLPRPDwvSE.YS&u1QSURk VCuVKDjh -EPCURELPEUU;LuE;P t 9t%jh#.jm ‰Qjj Ğt 9Ȟt%jh`-jVm ‰ĞȞQjjňURQEEvFEuX ̞t 9Оt%jh4.jl ‰̞ОQjjV evEPFlj1;uu ;]v}1WUREP!B}U|WF)]u}Fu }:u>P];t-CVS>t1ˀ;u܀;VE PW=Ã=PtShN.G=dtRS5 Ԟt 9؞t%jhU.jk ‰Ԟ؞Q5>jS4$uYS ܞt 9t%jhf.jKk ‰ܞQ>0j赆SA1΀>UREPAe[^_U4WVS1P1j[ǃ$(/v>vj Ph5 5 t/̤9h|"5 觅P5資 1u jhjjPu 1DžDž%FsDž7+)sсu +v;t9t 1uLP"vj |PKLPGcLu v$P=t R9L LDž9u;~(t 9,t#jh/jb ‰(,Rjj~0t 94t#jh/jLb ‰04Rjj}PF‰D;ƅuY8t 9<t#jh0ja ‰8<RjjE} vV;Ã;vSVQ7t3V;)V utYtCY&fƂ1֍t2/މ@dRh $u Rh $[^_ÐUWVSEƿ0u!ƿ%0u EjEdPU Bj EP6U BHu8=t/j EYPU B@j EePU BPu/jElPU BjEtPU B}=0u'U tE P PUujElPU B=0u'U)tE P)PujEtPU BU<3t <4u?jjEIPjEQP ËU Z B$U B B$e[^_ÍvUWVSM ]  uW}QMQ@t 9Dt#jh@0j$^ ‰@DRjjy  lDA tDžDž Ѓwm9#9 ׉ u ;DA }Huj`HjP藕 HP] SMQhSMQShLt9Pjh0j\ ‰LPx;]w!;Mu ;]wk}tZMQ]SM QTt 9Xt#jh0j%\ ‰TXRjjw[^_ÍvUjjh0u uAÍvUjhh0u u"Ujhh0u uUjjh1u ut v1ttt}ɀ@t@ t tttt t ÐUhjh1u ufUjjh 1u uMÍvUjhh1u u.Ujjh1u uÍvUjjh!1u uÍvUWVS]u }OOjj VS$0jj VSÉ։ uՉe[^_ÍvUu,2rrr B@PBlPh+1h\1\USMU Btr-B}w-Bt@tsvS@txv-B tr-Btw-BttsvStxv-Btr-Btw-BtttvTtxv-]UWVS=t]}Pg2RPdPtt 9xt#jhI1jX ‰txR5-+=d15  ǃt WhT15 hT1kE?V$2EVvEMvENv|t 9t#jhX1jW ‰|Rjjhs ME- 1р| /u-Ed'vElEbEcEpECMQ50uhddP!`@փ t=t \(EPjFlPuRP\ )t=t )&EPjBtP1RPCƃ ߀34~ StQwv@P @DHLHSho1EPP-YMQj R@DRPvEP LPSQ R]PS.\1щTщXP)TTXT=9~׋`QPShw1)WV\PMQhx15'$5 { ǃtWh15'W,5 h15' V$`35 ǃtWh1`5h15 ǃtXWt 9t#jh1jT ‰R5&W7+v5t9Ejh1j-T ‰vPt9jh1jS ‰5j w*t9jh1jS ‰]Sj qRƉWV RPPZ+PQt 9t#jh1j S ‰R5z% Jt 9t#jh1jR ‰R5.%5p%4[^_ÐU$WVSu} =dBEdEPu`=tZEP+RPPt 9t#jhI1jR ‰R5$VÃtcSWt 9t#jh4jQ ‰RPEPh45$SS([VWğt 9ȟt#jh4jYQ ‰ğȟRPEPh45#e[^_ÉUWVS]u =ܤ5 5*Dž̟t 9Пt#jh0jP ‰̟ПRjj!lԟt 9؟t#jh/jlP ‰ԟ؟RjjkW`*=ܤt2u(e[^_U)tP*vP)U WVS LPM]E@PߍEEE1҃9Eu9Uu}}ܟt 9t#jh4jfO ‰ܟRjjjt 9t#jh5j"O ‰RjjjE](EuTt 9t#jh@5jN ‰Rjj0jvMQ(lj}E]9]9Mu]9]v }}EWMQ]S#]M])M]]DPD(}+u }M9vj ]SGjh`5S" uj VEjhh5MQ" t Ej ]SӉM/uG]]S1SV& tGSVt9Yjhm5jDM ‰1=dMQVt9ojh5jL ‰Gvjh5]S! 9uj VEjhh5MQ! tEj ]SӍvMV$]]SSV"t{S=SV"t`MQVt 9t#jh5jL ‰RS0jzg=d]SV t 9t#jh5jK ‰ RjjgVMQt 9t#jh5jSK ‰Rjjf}?e[^_ÐUVS]u t P!t V耉e[^ÍvUWVSEEE11E8IE0@E\uM}u8+]KE1эLQ螈SEPW ;\B\vlDp@t}v}u:]+]KE}1эLQ/SEPW;\B t' t8 t#I t3 t:t+1nIvtAvf9vb1vr)v?!v 0B$ 0B$ 0BE8}u1ve[^_ÍvUVSUр:<\ADwm$6\.v &v v vv vBALXA<w\A<w\AB1\Bt9tABBр9T9te[^UWVSu] uu+M41VMх~M1E41vCE<EHt MHuMMQMQMQVhƋMQMQWSWÍ} tCvt1SVMу}M17<1vM<Ӆu˅t7vEe[^_ÍvUM1t.uQt .u yuUdWVS}EPWj E%=@} thWbEu5tXS{!SW5jVtPVURܿURWHË3W| 131)NjV=URWJe[^_ÐU`VS]u t+=u"j:S t9v x/gEPSjS t0WDSh7PjnavE%=@t=`= Shjhx5S^uUhF7jj`t 9 t#jh 7j=E ‰ Rjj`55uc=dtR55$t 9(t#jh`7jD ‰$(R58h5,t 90t#jh7juD ‰,0R0j_jh+1e[^ÉU5Pt\54t 98t#jh7jC ‰48R'0jN_=dtU55<t 9@t#jh7jwC ‰<@R5jh7ÐUWVS}] t ;=uq u= t;=t.WEƒu =>=j 2V0 }1уv  j VSe[^_ÍvUWVS}] t ;=uu@u=@t;=t2*Wƒu ===j 2V }1уv  j VSce[^_ÍvUWS]`=`1Iw{IwQ`)…tMuISa)ƒv7u3Sb)ƒv!uSc)RS…uvj RSs   8 1IwuIwO )…tKuGS!)ƒv5u1S")ƒvuS#) RS!…uGj RS t5Sƒuj Sh`1%Bj Sh E e[_UWS]=1Iw{IwQ)…tMuIS)ƒv7u3S)ƒv!uS)RS…uvj RS @ @8 1IwuIwO@)…tKuGSA)ƒv5u1SB)ƒvuSC) RSa…uGj RS t5S^ƒuj Sh1%Bj Sh@E e[_U j(|ÍvUS ; u+MP5z| E]Ujf*|d\uBuh7 p h7R 5\Dt 9Ht#jh7jr= ‰DHR0jXLt 9Pt#jh8j)= ‰LPRjjXU55ÐUVS1Avx9tH;u SdCfP5{C5 7ƃuu u13;uSdCfP5ze[^ÉUWVS1=xuE= t.y;1I; v351эAAQy‰S51эL 9vv9/uI9wR5Tt 9Xt#jh&8j!; ‰TXRf0jV\t 9`t#jh8j: ‰\`RjjIV1v}t*HӅuBHuJu WvR*= dt 9ht#jhG8j2: ‰dhRjjUlt 9pt#jh8j9 ‰lpRjj_U1e[^_ÐU t9;pt1Pju#5hb8 0jUÐUWS=(=u*|j|xwt5jPZ jÃlPӅuCPuSjPwjà xt 9|t#jhG8j8 ‰x|Rjj+Tt 9t#jh8jv8 ‰RjjStx 1ItHQ;rRQdvtqSAPQtBDt@tԤvSj|Ãue[_UWVSMƒuAƒ½uQj8P vj&E t 9t#jhG8j17 ‰RjjRt 9t#jh8j6 ‰Rjj^R:/hthS t 9t#jh8ju6 ‰RjjQt 9t#jh8j16 ‰RjjQ5S[S }t}1эqv1^SsǃSjW }t GwVMQ_S GGG G G G}t`1j*EP>ƒu%j[MQ*ƒuj?EP…ttG M*t [t?uG t:==Ԥu=Ԥe[^_ÉUWVS}1эy5Ԥvu ~V RA v t 9t#jh&8j^4 ‰R0jOt 9t#jh8j4 ‰RjjOԤ1v{ tE8C { jEPCPƒ C=t5Ԥb ԤS R$s t 9t#jh&8jA3 ‰R0jNt 9Ġt#jh8j2 ‰ĠRjjiNS9E t /RCPEPƒ C=t5ԤS ԤS Rs Ƞt 9̠t#jh&8j22 ‰Ƞ̠Rw0jMРt 9Ԡt#jh8j1 ‰РԠRjjZM=(t!Ԥxt%Ԥƀ~1e[^_ÉUSԤtlvxu[xuUPؠt 9ܠt#jh8j=1 ‰ؠܠRjjL؅uԤ=(tbRPt 9t#jh8j0 ‰Rjj7LjOܠ]ÍvUÍvUWVSu1эyԤӅtz{ t8Cu?{ tjVCP u&PS9w 2t/u RCPV*Ӌu=(tԤxtmԤ€zt1e[^_ÉU塴u Ԥxt u@@ P-p t 9t#jh&8jE/ ‰R0jJt 9t#jh8j. ‰RjjmJv1UԤt @uUWVSu] 1҉RlSVh8We[^_UWVSU4;43;3U e[^_ÉUWVSu jj E1эYSVE4 Mƒ9tEPj jEP[ EPj u1e[^_ÍvUWVS1] M<jSj ; tFC?~ڃ@u vv] v uCu<wLƍCjj jPu} tjVj t;Fu"F0AuCjMQm1e[^_ÍvU@EPutjj jPÐU`WVSEPuǃEEG t t-ȉM1u+uEUEUM]}tMȉڋM])MȉڋM]ӉM]jj M]SQt;Eu>;Uu9}t]9]+9Mu1]9]w'vM9M9]uM9Mv &M]M]ЉEG EUe[^_ÍvUTWVSEM4<u<t E}~}uN]uhiEE1EƒM4:t2<:t<@u!u}JM}u JMB:uυt?u1}uE8MQEEtE vMMP9P tÃdju4H4`UjNč4!64. 6PPPt&jh8Wh8MQMQMQ@vjh8MQMQMQ t 9t#jh8j() ‰Rm0hD čshu MQh8]SSSMQ tMQu 0MQDMQgMQWEEe[^_ÐUVS]h8SUtS0Se[^ÍvUDWVS} uh8]SSURt URHƃu jUR719s-UU)PWULe ~9r݉e[^_ÍvU@WVS}uVh9]SSWotIjj >Vu 4F9tSj jWSj Wre[^_ÉU`WVSM ]M]}} ]U]}Ojj M]SQr0jj M]SQfqEUE EuŃ}}O-}t }t v}t]SWh 9MMQ]SMQet ]S e[^_ÉUdWVSE =m=m@t_hMAM]} كۉM]}Ojj M]SQq0jj M]SQZpEUE Euŋ]{}O-WMPh9]SSMQx]Sh9MQN/]Sǃ~0M4W]SbE ~)É]ۋM9Gj]SE9}})uFMM]]E9}|1e[^_ÐUS]tMSP t 9$t#jh 9jq$ ‰ $Rjj?j_]US==t =thQ9hS9>h\9Rp=(t 9,t#jh`9j# ‰(,Rjj,?0t 94t#jh9jw# ‰04Rjj>u uh9555à tvt5 u1yYu]ÉUS]tU58t 9<t#jh=j" ‰8<R5h% 5d@t 9Dt#jh=ja" ‰@DR5Ht 9Lt#jh`>j" ‰HLR}5dPt 9Tt#jh>j! ‰PTRt5dXt 9\t#jh@?j! ‰X\R+5d`t 9dt#jhAj=! ‰`dR5dht 9lt#jhDj ‰hlR5dpt 9tt#jhGj ‰ptRP5dxt 9|t#jh@Jjb ‰x|R5dt 9t#jhKj ‰R5dt 9t#jhMj ‰Ru5dt 9t#jhPj ‰R,5dt 9t#jhQj> ‰R5dt 9t#jh@Rj ‰R5dt 9t#jh`Tj ‰RQjhVt 9t#jhUjb ‰R 5dt 9t#jhWj ‰RSUS]TtO9tKt 9ġt#jh@Wj ‰ġRjj,9jT]ÉUS]<tYSPtKȡt 9̡t#jhWjE ‰ȡ̡Rjj8j3<]UPWVSETLФ( :‰ĤhWaE؃}KE @8-<E-Eu ~1ыuLMQZE̋E ủ}̃E @E] uuȄUEPZ‰u6VhW…tqz:ukE E9s UEPСt 9ԡt#jhXj ‰СԡRjj%7jEuOU U9s9rEЉEủu E  $]jA 5tE jCءt 9ܡt#jh@Xj ‰ءܡRjjP6 t 9t#jhXj ‰Rjj6 hXEPj j5tYu"U~ Ф 9 t9 jhXj ‰ t 9t#jhXj ‰Rjj85 l jhY"5tE vj l; u,MQ5W‰ ltl thܤ vt  vX  8 5ta vȤO hXEPj j5tY=tNt 9t#jhYj1 ‰Rjj3jE1 t 9t#jh@Yj ‰Rjj$3 X=̤tNt 9 t#jhiYjH ‰ Rjj2j6j5tJG̤5tt 9t#jhYj ‰RjjG2j~LuLevYt9*jhYjZ ‰ t 9$t#jhYj ‰ $Rjjl1 4j(t 9,t#jh Zj ‰(,Rjj 1 @/j]dvt\jgDdt`Pjj 5t52 5thPZ0j-00t 94t#jh9jx ‰04Rjj/'h=hX<h<8t 9<t#jh`Zj ‰8<Rjjx/ tUj5t5O1qvt1IwhR+>hX]Sj j5tVu%MME;Muu9su @t9DjhZj ‰@Dj5tGuQHt 9Lt#jhZj ‰HLRjj. =?Pt9TjhZj@ ‰PTxt1IwhĤRhX]Sj j5tUu%MME;Muu9su ĤjXt 9\t#jhZjo ‰X\Rjj, LuLv`t9djhYj ‰`d(vhX]Sj j5tS=uM܉ME;MuE9CtQht 9lt#jhZjW ‰hlRjj+jEM܉ ФtShpt 9tt#jh [j ‰ptRjjd+j5Ф 5tH~tEjt^5tNxt 9|t#jh`[jS ‰x|Rjj*jAjhhWu VEP!ƒ= h[h[h[b 5dt 9t#jh[j ‰RY5dt 9t#jh \jk ‰R5dt 9t#jh\j" ‰Rj=t jLuLuh\ut L=`u=u=ܤu =t^LtStNt 9t#jh]j[ ‰Rjj(jI=lu1lh3]¡:uV=l~W=ܤuNt 9t#jh@]j ‰Rjj2(j=ؤt DTJ$T`}=\zt 9t#jh]j0 ‰Rjj'j',5l9, XӅuYuh],B,5lƃ9rv,5l9, XӅuYuTt 9t#jh]j- ‰Rjj&j,B,5lƃ9o,}tuVVI‰ē=tEPh]%‰e[^_UVSu] hXjht`h[h[x  j(_Hljj SVSV=tT$avt 9t#jh`j ‰Rjj,%jYvckO=tt>M=tt-V&ph45h^ O%h,Y=t@5 uLt 9Ģt#jh`j ‰ĢRjjS$ PEUWVSEPMQj uj]S7l}^MQȢt 9̢t#jh@ajQ ‰Ȣ̢R0j#rM̋]Љ\`1hPGd1҃;` u9;\v1\d߁thڸ)PjR dQhSlQEǃ ]SdQEPE̋U+\`RP֬ PТt 9Ԣt#jh`aj- ‰ТԢRr0j"آt 9ܢt#jhaj ‰آܢRjjU"$ȉ)\`G}%hP;dEP\`SQP]St 9t#jhaj= ‰Rjj! t 9t#jhaj ‰Rjjg! `u \lQ,P[^_ÐUhWVSE1 =Tuj蟠ƃ$dbv=T5 EjEPh 5蘤EP5 jP }a5 t 9t#jhbj ‰R0j: vE9h|MA5ta LPSQ65E}]$xbt 9t#jh bj ‰Rjj\ t 9t#jhFbj ‰Rjj vuA=PtVh^bt$=Tu VfjjjVH0ƅu<ge[^_ÐUu uFUuu uÐUu u2 Uu9 ÍvUu5ÐUWVS}E8u 1)tsEP…t|ًu} utSbsE P…b1Iw^E b)…tZuVE Pb)ƒvAu=E Pb)ƒv(u$E Pb)vVE P…tE P`Džu 1VSbtR{8j ƃt͋EP‰Vtb1Iw^E b)…tZuVE Pb)ƒvAu=E Pb)ƒv(u$E Pb)vRE P…tE P|‰VuvFbtrEP…}54vtrEP…~ …u3Ce[^_ÐU WVSR‹U} u 1}uE Mt-EpMQ!…t|EEuڃ}u EbMy?/u }1ӾD$)ĉe"ƒ:"u( $)ĉeVMQ%Ãt̅&MqjEPf/BRMQSEPE1ҋ}֍t2 )eEPSMQf/BR.mo}1҃)ԉevE:uEM:tuEC@ vU쐀:tEBM ˄uMƒ½uQtu쿯bu9‹EE oMQEPMQcƃ ^E PVPÃu/V~t׋M Q71Ãu?u‹E؍e[^_ÉU0WVS]{u St[]ExH ΅} 1IM] 1ɀ;t Cρt11݉URU؉1u؉UE؃E1uC]E@ EDžtUUEx tEPLMeMeeE EMeU U M܋MME@MLQU R1}~ {9q9seE0x tFPLMeMeeE EMeU U M܋E܍ 0vURL11ɉȍe[^_UEwA$cb6b.b&bbbbbÐUh ct8uBhbit8u,u Ut8uh)c?t8ubÐUju ulÐUujÐU(WVS]u jEPjjjjjjjVj1QSh ǃ8t_u W;#1t(_vzu Rzu F;uޅ|1҉vVE܃tPƅtmEPEPEPEPEPEPEPEPVKƒ$jEPuuuuuuuuR1QShǃ8u1Ou WLu,t&_zu R*zu;u߃}tVe[^_ÐUtWVSEuFFjPEEEPuVj ủuuE9uu;uw}mjuVjjuVj(ǃtuVECuVǃ8]}SuVuV E)uVI=t)=t"}tuVWWjj$]Ëu^;usus?%C t+G   O{ t+G   OK{ t,O % %  ʍ:@ C{ t*O% %  ʍ:@C{ t*G   OK{ t,O% %  ʍ:GC B}tuVW vWSuFuVGe[^_ÐUWVS1hv1ۉtQ<:uЍz=x:t ʀ9t::tz=Bu9s)RQPÃtt8}}thjP5 EP1fpe[^_ÐU0@WVSE $)ĉM QuSwBcBcM BDJE LfR fT hPcSu 1DžoQh Vƒ bj V/u2Ph Sƒ tj St։=lDG t BDC u ΄#Bxt2HDK uB:tDG t:tB=lvBDG u:vBxtHDO uB:t DG t u B t9rw1֋щȋ9v=1sS5.ƒ  VPR)‹55 QP P‹TQƒyPthj55 Ŀ[^_USt EdP5 t ]UUE 02UWVS]5;txb1IwOb)…tKuGSb)ƒv5u1Sb)ƒvuSb) RSA…u bSbtVpe[^_ÐU,WVS}1ыuTEEe t}1ʋuuet} 1ʋuuet}$1Et}(1ʋuuet},1ʋ}81эYuuetPt}01AMEEt}41MʍTU؍TvTR>E؃uVE PuVj:EPVE|/GuVW[ǃ}t_GEPWBǃ}t.Gu VW)ǃ}t.GE$PWEt0GE@t+vE@u(VWھǃ}t+GE,PWǃ}t7,G]Etu0VW蛾Džt_GE4PW脾/Gu8VWq1EEt8utEPR荾…tJ}uv uu΃}u}<uEPuVE PÃU⪪uu܁eUUU܉U܁e}33U܉U}U܁U}MSAEu1}u؋E01ۋEPu V)ƒu EuEX@uu6p uvw Ep G EEPu VƒuEHEE؋uu}vEЅEEGt EؘE؃1{vjE8Pu4VE0Pu,VE(Pu$VE PuVEPEP1QSuV‹Eu@E8t} }9s!jS!P9r }tU 1҉ӅpM3EuEe[^_ÍvUWVS1ɻ1;U s&5lv}:fFtAt1B;U rtAAPWEtTtisoÃv]1;U s3uvlfHt `tCFB;U rEe[^_ÐUWVSE MMMMM M$M(11],tCt_t @t+u9ujS衺_CM_tCt.t@t +t,u .uiCM@tCuM M9t>9t9)PQIMPM1~uM1;v@u v+u3CM_tCut +t,uto<v_u[+u!CM _t Ct,u,uCM$_tCu_u CM(u>MM Mt8u߃}t M9uMt 8ue[^_ÐUWVSu1эQēуsʉUЃPkǃtbVW諾} tIW)f8.WPDƒ} utE8BRh\cSƽ VW\j~SW+e[^_ÉU WVSu sEt}E}1эq::t3Z1эQF9rVSEPAƒ ;U~UEP苻ƒuEPٻ…uE1e[^_ÉUWVS} u1VWu舺u4<>.u.|7~u'L7 \BABЃ v9~uyt1ۉ؍e[^_ÉUE t8u &5ГjjhchdcPu7-cÉUE t8t PuvhcrPhcÐUSUӹЀ:tv8/uP1@8u:u ;/utJЋ]ÐUVSu] t$5d-5hc5hǶEPu5hb tS/Phc5h莶5hj 论5hö tVfe[^ÐUWVS} ]u=t395u9SP5t$5dI5hd5htVShd5hʵEPu5he tW2Phc5h葵5hj 豹5hƵ }t URde[^_USj CC@h ؋]ÉUWVSEx19}(։jM Q6Ǵ u C9|1e[^_ÉUVS]CK94EsP3y KE Ce[^ÉUWVSU MME:-u zȉM1E}u!hdREu pMhǃ>F9uuSWǃMQuԍFPWNjMQ t 諴E}uMQt 苴E9w29s M8 t v9s{tPMQCC9vEM1e[^_ÐUWVS} uEt.VWURà }8tމ])эvEe[^_ÐUWVSpDP@Dž<1DžHnLDžLLf:DD9L@4D)LLLC<'~8hgr 1tDRe@PY: v<'~ Dž<'<ƒ)ԉD4]VQDP˴< )ԉ@S4P@R蠴DtL@tT 9Le0f u 2 Dž#wd Dž 3w{ ]zg;ueg}_==t HPHE0ek],e~)8K/$h04$(,yF@DLvF@FDLF@FDT4ۉ(Q+)()ˋ( F@FDFLTF@FDFLT4}Nۉ$Q+)$)ˋ$ NQ+)Ӊ) ى 8v8ĉ8Fģ8 F mF XFvvN~ PF] HF<VPFأHډ<F<VHأPFH<FHF<OvHF<FHF<#vh`\Xdl_vFlKvl;vFd'vdvFXvXvF\v\vF`v`vFhvhv 0t=$t=,u P\>'$ϋ+)У<+)ʉ)ӉHh + PA 0c @DNQ)ˉ@Q.+ )УDLTDž88))L8,&eKMfL׃3w&}Lff9zgu gW1%1tDR&@P[^_ÉU1ÐUUE t"r u7wB w u1҉%B v u1ҍB vÉUE}؃D clUWVSM9t&vlDPt`A9u݋EJuFuNtEiquuuFƒ“uVtEqqupv}1u E0}1uu~.u EFEh=htQh}t$jREP蔩ƒ u"GRuV¦…tm ;ul=lt3EP蕦…t@ ;uuƒœuFƒuFƒŒuVudvCCQj=jt3uV!…t̃ ;u}1эyu<7su87j=jtv3EPե…t ;uu7s\k=\kt#v3EP补…H ;uu~u?lDPt0o=ot"3uVY… ;u1Uр9t.tAGB:ut.l=lt 3EP… ;ue[^_ÍvUWVSv lDA tЍz=@DA u эBЃ v-t+-t +u- v{=CЃ z1DBУB v }t vlDPtLu"vE9s CѡlDPuڀ.t VnB(t 21҉t(uB v)uJ}1e[^_ÉUWVSEXkU BkEREH)щ]}UU}E)EMQ]}+uQmEE}+}u)}+Mu}}}U)UM)ÍۍÉ]э IE @EEP+U ʉMe)ME @EEP+UEEe)EU UU+EU ȍe[^_UpWVSE] t jEEEPÃGSlPKA HC <S@K DL[ ]Th`\Xdl$(,04QÅ=0s=4f=$Y=(L5P¡l‰UdHHEX<E=0u=,tE=$u<=(u35T5@E܃DEءLEEEE\Eܡ`EءhEԡ$ ( 0 X d ltE}}u ]SEƃuP=4t>ߋu }FE8`M8S虡Eƃ=(=$ +EE$ImuuMM}E)EUM)ʋE)ЉEu= )W)EƉuSEƃtX=4tMUR'ƃt/VS¡8+8U99t]މe[^_ÐUj…t B =BEBB1UEM U8uP ÍvU$WVS}Eh|qEPjEPW u=E=[Pe FPEPEPzE0jEPOEEGЀgt  at1;votuu.M אM8͍vMvM뵍v}t EEEM M<=Rj葞ÃdC u}u/<=u0Mt#jePUREP ?=t$UE?+u Mu%vMuUEMtu#usCCSRP(G U߀¨€X $q%$ Ce% CYKI CK% C=% C1{urC{ubC8{uRCKGi}=+-, uEuvup1e[^_ÉU`EPujh t 3jќ…t=BBEBB ÐUWVS}u FF!©t't $v1}@tT P8t$ t1tɄt+ A't 1tɠt H ȉ#VVt%=@tIuⶊ<-t<+t<=uF! !Ӌv ؍e[^_ÍvUSEtX P胞؃u]ÐUWVS]j$ޅu e[^_ÍvUEuÐUUuE ÉUWVSuU] %t| ǁǤ711։7e[^_ÍvUWVS} UUuEM Mw t}}u];u}U<#<~t}E1}uM<u;u~]]Ãsw$TrEЋE]u9}s]UMvEF뎉E'vE" vEE}t9}s ]UvE1}u M9u;u]]}kU$$t}'U9}s M] 'vE9}s UM\E9} ]U'MMȃUwg$8tEavEbvEfvEnvErvEtvEvv}hl]ڃEM1e[^_U WVS}E ӋEU7uWUSQEURP9u9_t EUW1e[^_ÍvUWVS}u ]Kt vVWut  vs1e[^_ÐUWVS}}$vhxj{h xh x蘏u uulDC t BDC u:-t5賏jMQVWEU;M9u }M9PMQˍj0MQ赍t@EUMQ1e[^_ÐUWVSu uLÉ1эQуL w VP9w EDe[^_ÐUj*UWVSU EE}1IME:E}tEPEPRZEPEPRZƒ uN;1IE9t[}u EE*}tEEuƋ}}MtEEEE;n}uEvEve[^_ÍvUjuuu uUjuuu uUVS]jjj u>̣t 9Уtajh yj! ‰̣У<ԣt 9أt#jh@yj ‰ԣأuu PSjjCVjKe[^UWVS]Eܣt 9t#jhayjl ‰ܣR5hۊE;tlM MEv}tu} }MtPhvy5h萊MMPhy5hw MMME;u5hj 胎e[^_ÍvUWVS] }uuVWURS}PSu!VWURU Ҹe[^_UWVSE 8t%1ҋu}׋MuU8u1e[^_ÐUDWVEEU EUUMUM}}*EMىMĉ΋E؉EtHE}u}}}$UE؉EuޅtNuUMUM}MMEEuu=9v E}u 1lj1E֋EEv9uvEvUUu;uw9}rۉEsvE M)M܋E}MmU ЉEċMu؋Mm؋MEEMm uMEUuĉEĉUƉ;}wu;uvMEMĉMЋEEԋuЋ}ԃ}t؉EȉޅtNűuȋ}̉e^_ÐU WV}EEUUM MuC9vЉE}u 1NjE1EUEEvU9Uv EuuM9Mw9}rމEwvE )uE}MmU ЉEEEMmEEEMmE EeEUuEUƉ;}wu;uvMEMMEEEUe^_U(WVUUMMUUUUM M؃}uT9Mv Љu&}u 1uEE1uU؋EuU}u1M1yU9Uvu׉u}MMu8U9UwM9MrM؋U+UMM؉U}u}E M)MeEM EMeU؉U܋Mm܋MEM ‰U؋MeЋUuUeU܋M9wu;Ev U+EUU܃}t+M؋U)M܉M؉ȋMM Ƌ}U2zEUe^_ÐUSؓ=ؓtЃ;u]ÍvUÐUS[;迊]Total bytes written: %llu Cannot close file #%dError is not recoverable: exiting nowCannot close descriptor %dCannot properly duplicate %sCannot open pipeCannot forktar (child)(child) Pipe to stdin-Cannot open archive %sArchive to stdoutCannot exec %sChild cannot fork((child)) Pipe to stdouttar (grandchild)(grandchild) Pipe to stdinCannot read from compression program(child) Pipe to stdoutArchive to stdin-d((child)) Pipe to stdin(grandchild) Pipe to stdoutCannot write to compression programWrite to compression program short %lu bytes Volume [1-9]*Invalid value for record_sizeNo archive name givenCould not allocate memory for blocking factor %dCannot verify multi-volume archivesCannot use multi-volume compressed archivesCannot verify compressed archivesCannot update compressed archivesCannot verify stdin/stdout archiveCannot open %s/dev/nullArchive not labelled to match `%s'Volume `%s' does not match `%s'%s Volume 1Write checkpoint %d%s Volume %dCannot write to %sOnly wrote %lu of %lu bytes to %sRead error on %sAt beginning of tape, quitting nowToo many errors, quittingRead checkpoint %dReading %s WARNING: No volume header%s is not continued on this volume%s is the wrong size (%s != %s + %s)This volume is out of sequenceRecord size = %lu blocksArchive %s EOF not on block boundaryOnly read %lu bytes from archive %sWARNING: Cannot close %s (%d, %d)Could not backspace archive file; it may be unreadable without -iWARNING: Cannot truncate %sChild died with signal %d%s (core dumped)Child returned status %dr%d%sw%d /dev/ttyPrepare volume #%d for %s and hit return: EOF where user reply was expectedWARNING: Archive is incomplete n [name] Give a new file name for the next (and subsequent) volume(s) q Abort tar ! Spawn a subshell ? Print this list No new volume; exiting. Cannot fork!SHELL/bin/sh-i-shCannot exec a shell %sCould not allocate memory for diff buffer of %lu bytesError is not recoverable: exiting now%s: %s Cannot read %sCould only read %lu of %lu bytesData differsUnexpected EOF on archive fileCannot seek to %s in file %sMemory exhaustedFile does not existCannot stat file %sVerify Unknown file type '%c' for %s, diffed as normal fileNot a regular fileMode differsUid differsGid differsMod time differsSize differsCannot open %sError while closing %sDoes not existNot linked to %sNo such file or directoryCannot read link %sSymlink differsDevice numbers changedMode or device-type changedNo longer a directoryCannot open file %s;;x$0;;Could not rewind archive file for verifyVERIFY FAILURE: %d invalid header(s) detected%s value %s too large (max=%s); substituting %s%s value %s too large (max=%s)gid_tmajor_tminor_tmode_toff_tsize_ttime_tuid_tuintmax_t././@LongLinkRemoving leading `/' from absolute path names in the archiveustar ustar00CC Wrote %s of %s bytes to file %slseek error at byte %s in file %sRead error at byte %s, reading %lu bytes, in file %s/addCannot add file %s%s: is unchanged; not dumped%s is the archive; not dumpedRemoving leading `/' from absolute linksCannot remove %sFile %s shrunk by %s bytes, padding with zeros%s: fstat%s: file changed as we read it%s: closeCannot add directory %s%s: On a different filesystem; not dumpedCannot open directory %s%s: Unknown file type; file ignoredCould not re-position archive fileError is not recoverable: exiting nowThis does not look like a tar archiveSkipping to next headerDeleting non-header from archive@(H((((())t)|)%s: Cannot change mode to %04lo%s: Could not change access and modification times%s: Cannot lchown to uid %lu gid %lu%s: Cannot chown to uid %lu gid %lu%s: Cannot change owner to uid %lu, gid %luUnexpected EOF on archive file%s: lseek error at byte %s%s: Could not write to file%s: Could only write %s of %s bytesextractRemoving leading `/' from absolute path names in the archive%s: Was unable to backup this fileExtracting contiguous files as regular files%s: Could not create file%s: Could only write %lu of %lu bytes%s: Error while closing%s: Could not create symlink to `%s'%s: Could not link to `%s'%s: Could not make node%s: Could not make fifo%s: Could not create directoryAdded write and execute permission to directory %sReading %s Cannot extract `%s' -- file is continued from another volumeVisible long name errorUnknown file type '%c' for %s, extracted as normal file8hGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhG8?>AApChB8hGhGhGhGhGhGhGhGhGhGhGhGpChGhGhGhGhGhGFFF|FhGhGhGhG7hGhGFCannot open directory %s/NCannot stat %sDirectory %s has been renamedDirectory %s is newDYCould not get current directoryError is not recoverable: exiting nowFile name %s/%s too longrCannot open %sDevice number out of rangeInode number out of range%swCannot write to %s%lu %lu %lu %s .Cannot chdir to %sMemory exhaustedUnexpected EOF in archivedelete%s: Deleting %s Error while deleting %sOmitting %sblock %s: ** Block of NULs ** block %s: ** End of File ** Hmm, this doesn't look like a tar archiveSkipping to next file header[[\H]]]^^d[d[EOF in archive fileOnly wrote %lu of %lu bytes to file %sMemory exhaustedError is not recoverable: exiting nowUnexpected EOF on archive fileustarustar Blanks in header where octal %s value expectedHeader contains "%.*s" where octal %s value expectedOctal value `%.*s' is out of range for %sgid_tmajor_tminor_tmode_toff_tsize_ttime_tuid_tuintmax_t%4d-%02d-%02d %02d:%02d:%02d block %s: %s Visible longname error%lu,%lu%s %s/%s %*s%s %s %s -> %s link to %s unknown file type `%c' --Volume Header-- --Continued at byte %s-- --Mangled file names-- \nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn\n\nnnn{nnnnnnnnnnnnnnn{nnnnnnnnnmmnnnn\nnnm`rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr`r\q0q`r`r`r`r`rrrrrrrrrrrrr`rrrrrrrrrr@srrrr`rrrtrCreating directory:%s %*s %.*s Memory exhaustedError is not recoverable: exiting nowUnexpected EOF in mangled namesRename to Cannot rename %s to %sRenamed %s to %sSymlink Cannot symlink %s to %sSymlinked %s to %sUnknown demangling command %sH}H}H}H}H}H}H}H}t}t}t}t}t}t}t}@}t}t}t}t}t}t}t}t}t}t}t}t}t}t}t}t}t}t}t}t}t}t}t}t}t}t}t}t}}t}t}t}t}t}0}t}t}t}(}t}t}t}t}t}t}t}}t}t}t}8}t} }%sError is not recoverable: exiting nowVirtual memory exhaustedRenaming previous `%s' to `%s' %s: Cannot rename for backup%s: Cannot rename from backupRenaming `%s' back to `%s' --TrCannot open file %sError is not recoverable: exiting nowCannot change to directory %s-CMissing file name after -C%sCould not get current directory%s: Not found in archive%s/%s/usr/bin/rsh/etc/rmt-lCannot execute remote shellO%s %d C R%lu W%lu L%s %d I%d %s SOptions `-%s' and `-%s' both want standard inputr/dev/tty-wCannot read confirmation from userError is not recoverable: exiting now%s %s?volno-fileversion-controlversionverifyverboseuse-compress-programupdateunlink-firstungzipuncompresstouchtotalsto-stdouttape-lengthsuffixstarting-filesparseshow-omitted-dirssame-permissionssame-ownersame-orderrsh-commandremove-filesrecord-sizerecord-numberread-full-recordsread-full-blocksrecursive-unlinkpreserve-permissionspreserve-orderpreserveposixportabilityownerone-file-systemold-archivenumeric-ownerno-recursionnullnewer-mtimenewernew-volume-scriptmulti-volumemodification-timemodelisted-incrementallistlabelkeep-old-filesinteractiveinfo-scriptincrementalignore-zerosignore-failed-readhelpgzipgunzipgroupgetforce-localfiles-fromfileextractexclude-fromexcludedirectorydiffdereferencedeletecreateconfirmationconcatenatecompresscomparecheckpointcatenatebunzip2bzip2blocking-factorblock-sizeblock-numberblock-compressbackupatime-preserveappendafter-dateabsolute-pathsabsolute-namesTry `%s --help' for more information. GNU `tar' saves many files together into a single tape or disk archive, and can restore individual files from the archive. Usage: %s [OPTION]... [FILE]... If a long option shows an argument as mandatory, then it is mandatory for the equivalent short option also. Similarly for optional arguments. Main operation mode: -t, --list list the contents of an archive -x, --extract, --get extract files from an archive -c, --create create a new archive -d, --diff, --compare find differences between archive and file system -r, --append append files to the end of an archive -u, --update only append files newer than copy in archive -A, --catenate append tar files to an archive --concatenate same as -A --delete delete from the archive (not on mag tapes!) Operation modifiers: -W, --verify attempt to verify the archive after writing it --remove-files remove files after adding them to the archive -k, --keep-old-files don't overwrite existing files when extracting -U, --unlink-first remove each file prior to extracting over it --recursive-unlink empty hierarchies prior to extracting directory -S, --sparse handle sparse files efficiently -O, --to-stdout extract files to standard output -G, --incremental handle old GNU-format incremental backup -g, --listed-incremental handle new GNU-format incremental backup --ignore-failed-read do not exit with nonzero on unreadable files Handling of file attributes: --owner=NAME force NAME as owner for added files --group=NAME force NAME as group for added files --mode=CHANGES force (symbolic) mode CHANGES for added files --atime-preserve don't change access times on dumped files -m, --modification-time don't extract file modified time --same-owner try extracting files with the same ownership --numeric-owner always use numbers for user/group names -p, --same-permissions extract all protection information --preserve-permissions same as -p -s, --same-order sort names to extract to match archive --preserve-order same as -s --preserve same as both -p and -s Device selection and switching: -f, --file=ARCHIVE use archive file or device ARCHIVE --force-local archive file is local even if has a colon --rsh-command=COMMAND use remote COMMAND instead of rsh -[0-7][lmh] specify drive and density -M, --multi-volume create/list/extract multi-volume archive -L, --tape-length=NUM change tape after writing NUM x 1024 bytes -F, --info-script=FILE run script at end of each tape (implies -M) --new-volume-script=FILE same as -F FILE --volno-file=FILE use/update the volume number in FILE Device blocking: -b, --blocking-factor=BLOCKS BLOCKS x 512 bytes per record --record-size=SIZE SIZE bytes per record, multiple of 512 -i, --ignore-zeros ignore zeroed blocks in archive (means EOF) -B, --read-full-records reblock as we read (for 4.2BSD pipes) Archive format selection: -V, --label=NAME create archive with volume name NAME PATTERN at list/extract time, a globbing PATTERN -o, --old-archive, --portability write a V7 format archive --posix write a POSIX conformant archive -y, --bzip2, --bunzip2 filter the archive through bzip2 -z, --gzip, --ungzip filter the archive through gzip -Z, --compress, --uncompress filter the archive through compress --use-compress-program=PROG filter through PROG (must accept -d) Local file selection: -C, --directory=DIR change to directory DIR -T, --files-from=NAME get names to extract or create from file NAME --null -T reads null-terminated names, disable -C --exclude=PATTERN exclude files, given as a globbing PATTERN -X, --exclude-from=FILE exclude globbing patterns listed in FILE -P, --absolute-names don't strip leading `/'s from file names -h, --dereference dump instead the files symlinks point to --no-recursion avoid descending automatically in directories -l, --one-file-system stay in local file system when creating archive -K, --starting-file=NAME begin at file NAME in the archive -N, --newer=DATE only store files newer than DATE --newer-mtime compare date and time when data changed only --after-date=DATE same as -N --backup[=CONTROL] backup before removal, choose version control --suffix=SUFFIX backup before removel, override usual suffix Informative output: --help print this help, then exit --version print tar program version number, then exit -v, --verbose verbosely list files processed --checkpoint print directory names while reading the archive --totals print total bytes written while creating archive -R, --block-number show block number within archive with each message -w, --interactive ask for confirmation for every action --confirmation same as -w The backup suffix is `~', unless set with --suffix or SIMPLE_BACKUP_SUFFIX. The version control may be set with --backup or VERSION_CONTROL, values are: t, numbered make numbered backups nil, existing numbered if numbered backups exist, simple otherwise never, simple always make simple backups GNU tar cannot read nor produce `--posix' archives. If POSIXLY_CORRECT is set in the environment, GNU extensions are disallowed with `--posix'. Support for POSIX is only partially implemented, don't count on it yet. ARCHIVE may be FILE, HOST:FILE or USER@HOST:FILE; and FILE may be a file or a device. *This* `tar' defaults to `-f%s -b%d'. - Report bugs to . You may not specify more than one `-Acdtrux' optionConflicting compression optionsSIMPLE_BACKUP_SUFFIX-01234567ABC:F:GK:L:MN:OPRST:UV:WX:Zb:cdf:g:hiklmoprstuvwxyzOld option `%c' requires an argument.Obsolete option, now implied by --blocking-factorObsolete option name replaced by --blocking-factorInvalid blocking factorObsolete option name replaced by --read-full-records-CInvalid tape lengthObsolete option name replaced by --touchMore than one threshold dateInvalid date format `%s'Conflicting archive format optionsObsolete option name replaced by --absolute-namesObsolete option name replaced by --block-number%sObsolete option name replaced by --backupInvalid group given on optionInvalid mode given on optionMemory exhaustedInvalid owner given on optionInvalid record sizeRecord size must be a multiple of %d.Options `-[0-7][lmh]' not supported by *this* tar1.13tartar (GNU %s) %s Copyright (C) 1988, 92,93,94,95,96,97,98, 1999 Free Software Foundation, Inc. This is free software; see the source for copying conditions. There is NO warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. Written by John Gilmore and Jay Fenlason. POSIXLY_CORRECTGNU features wanted on incompatible archive formatTAPEMultiple archive files requires `-M' optionCowardly refusing to create an empty archive-fOptions `-Aru' are incompatible with `-f -'--backup:|K8P0L\l|\Z̰ (HԱ?`pDPlp| ld8LI$$$/usr/share/localeYou must specify one of the `-Acdtrux' optionsError exit delayed from previous errorsD̼ؼCannot open file %sRead error at byte %s reading %lu bytes in file %sError is not recoverable: exiting now%s: File shrunk by %s bytes, (yark!)Cannot stat %sThis does not look like a tar archiveSkipping to next headeradd[[messages/usr/share/locale/.moCPOSIXLC_COLLATELC_CTYPELC_MONETARYLC_NUMERICLC_TIMELC_MESSAGESLC_ALLLC_XXX (08LANGUAGELANG/usr/share/locale:./locale.aliasriso~..~%d~cccccccctnumberednilexistingneversimpleoffnoneVERSION_CONTROL$VERSION_CONTROL%s: : %s%s:%s:%d: r &),#/0 %(+".$' *!-12 1 6 2<3:-. *+ ,!"#$%&/'0()31248597=;      8parser stack overflowparse errorP,PpP,<<P``t<Hj j j ~j zj uj pj ij _j  Zj  Rj  Ij  @j  9j2j*j%jjj jjjiisaturdayfridaythursthurthursdaywedneswednesdaytuestuesdaymondaysundaydecembernovemberoctoberseptseptemberaugustjulyjunemayaprilmarchfebruaryjanuaryTkNk Dk?k;k6k/k +k $k  k secsecondminminutehourdayweekfortnightmonthyearl l `l l ll lllll|ltlmlgl al Xl Pl Llagotwelftheleventhtenthnintheighthseventhsixthfifthfourththirdfirstnextthislastnowtodayyesterdaytomorrowoooooo<oxooo,o,ohohoooooooXoXoXoXooooooo~ozovoronokoLgoco_oZo\Uo\Qo MoHoCo?o;o06o01o0,o0idlenzdtnzstnztgsteadteastjstcctwadtwastzp6zp5zp4bteetfstfwtsstswtmeszmestmewtmetcetidlwntahstcathdthstydtystpdtpstmdtmstcdtcstedtestadtastatwatbstwetutcutgmtdq<bqx`q^q\q,ZqhXqVqTqRqXPqNqLqJqHqLFqDqBq@q\>q %d.%d.%d.%dInvalid netmask "%s". Invalid octet %d in netmask "%s". Invalid IP address "%s". Invalid octet %d in IP address "%s". %d.%d.%d.%d %d.%d.%d.%d \rƒ҃ , (h `8oĂooGCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)01.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.bss.comment.note# 1((@7 hh?GoToĂ c l u 8 ~,,/\\܃    @@ LLPPXX``,,, , nn x ELF,44 (444##`,,),) /lib/ld-linux.so.2GNUax2Y>qFw]%(CU.kM!+ @iS4 Xe#g9D;3nlA$?p-0HPftV&\v"j 1O'ab:`*)RZ=h^ TWN/5dc6JrB8s< _,G E7LuQKm[oI L.!5 :<B)I)P|?\,'"e)ov@^2""r"\2"ܕ3"ܗ"."\J"̘3")|3" ̗"̙@"|I+>"1ܛ:72CK>U@"["b)!j$r|>"wl~[:"LQl))#"̖:"3"|`"ܖ"̛@"L["\,|{  ,Z"(\"0 J9B\I2"N$U"_>"ll)s,%}C|"LD," $ܘ:L"|Jl<"$ܙ<)lZ" !>"(,07"<%]lf<yl̚u<|$ 9<L@"\"̕gL""`"C H|:"ܚ"))!__gmon_start__libcrypt.so.1cryptlibc.so.6strcpychrootchownprintfstdoutsigemptysetsnprintf__ctype_bgetenvsetpriority__strtol_internalgetpidfgetsexeclperrorputsexeclegetuidfeofmallocisattyendpwentsiglongjmpsleepoptarggetutentsetgroupsruserokfflushlseekgetdomainnamechmodalarm__sigsetjmpstrrchrsetrlimitwriteulimitenvironfprintfkillstrcat__deregister_frame_infochdirinitgroupsendgrentoptindstdinwaitumaskinnetgrferrorsetgidsignalreadendutentgetspnamopenlogcloselogstrncmpstrncpystrcasecmprealloc__strdup_IO_getcstrtokforksscanfsigactiongettimeofdaygetoptlocaltimememsetinet_ntoatcgetattrtimegetgroupssyslognicestrcmpttynamegethostbynamegetpwnamendspentgethostnamesprintffclosesetlocalestderrpututlinestrftimeaccess__xstatrewind__errno_locationexit__fxstatsetbufgetgrnamfopen_IO_putcfileno_IO_stdin_used_exit__libc_start_mainopenupdwtmpstrchrsetutentfputssetuidtcsetattr__register_frame_infoclosefree__environ_environGLIBC_2.0GLIBC_2.1 ii  $ii ii  ()))[)v) )2))1t';x'e|'S''6'G''n''''s'''J'h'R'm'\'t''*'E' '4'8'' ''r'O'Z'/'a'`'7("(^(L ((((](- (P$($((_,(d0(N4(8(I<(!@(D(.H(cL(pP(T(QX( \((`(>d(oh(<l(kp(:t(Ax(,|((5(=((( (Y(%(V(B(H( (W(l((T((@(U(b(F(g(u((K(j(&(?(f((D(0(+)X)C)q )M)9)#)3) )$)US[Ct_^]5l'%p'%t'h%x'h%|'h%'h%'h %'h(%'h0%'h8p%'h@`%'hHP%'hP@%'hX0%'h` %'hh%'hp%'hx%'h%'h%'h%'h%'h%'h%'h%'hp%'h`%'hP%'h@%'h0%'h %'h%'h%'h%'h%'h%'h%(h%(h %(h(% (h0%(h8p%(h@`%(hHP%(hP@% (hX0%$(h` %((hh%,(hp%0(hx%4(h%8(h%<(h%@(h%D(h%H(h%L(h%P(hp%T(h`%X(hP%\(h@%`(h0%d(h %h(h%l(h%p(h%t(h%x(h%|(h%(h%(h %(h(%(h0%(h8p%(h@`%(hHP%(hP@%(hX0%(h` %(hh%(hp%(hx%(h%(h%(h%(h%(h%(h%(h%(hp%(h`%(hP%(h@%(h0%(h %(h%(h%(h%(h%(h%(h%)h%)h %)h(% )h0%)h8p%)h@`%)hHP%)hP@% )hX0%$)h` 1^PTRhhQVhU=#u8P#С#8ut hT'r#ÉUÍvU th)hT'QÍvUÐUvU5*h5) =*uj5*h5)5*h5)tj}U?-u1IvC;]|ٍe[^_ÐUVSh#ÃjSxh1SƃtQ'v u5)j r5)ScV*Ãu5)eVOh@=tjhe[^ÍvUhtPhi.ht Ph#htj8/u PfPP%.ht Phh~tjP-ÐU5 *h5)j$U$#WVS`ajjQL Dž Dž)F0hj^Y-Eƒ *E 0)‰*M QEP Mœ$#y)M D9)tc#j5)Q E=#) #Dž !#) #Dž hE PMQƒ K#t!=#u =#t #u=#u =#t&=*u5*h5)Sj\jtjtjy j+v=*QN(1ցvljfhRP@ EQ!+=#u #tMh5 #hl h5 #h, 5 #h&*#=*tl@t=#tDž  #=#t/h`Pj Q5 #Cƒt #j jh1IHj?h7LPjh=vƒ t RM=#tjR%*u쀽`t `P=#u!hD]ƒtRhD)Q);U=#u =#t /)jE 4Qq E)M 1KSjR )@)B;U}M Q)UEP*=#u =#t  #&=ltl=,t,:t*RQhIhP'QhdhP}hhjjjPShShVq =thhhkQ hvDPh_4 jhyh7t hDQ>jjjjjjjj jjcnbcdefghijklmnopqrstuvwxyz{|}~ =uHjjÃtSÅthjPhj ahtejjÃt!SÅthjvQPhjRtSjsS hƒt5R;j5;1[^_ÐUvUWVS]S]tu ƃu oF8uZhVÃu1CvSE1IQjSQ vEP…ЉЍe[^_ÐUvU`+tPhhA`+ÉU`+tP`+ÉU WVS]S #uSh W# 9tSfyj WGÅtj:W3ÅtT)=wICWh`*`)`*0j:S…t1сv1"Sh*@*5@*D**[^_ÐU`+u `+PÉUVSu*3VtuBuvÅu1e[^U WVSDžhhƃu1fDžL/#t&1D EPRN…tVh Syƒ 9tV[^_ÐUEU tup0hR@t1ÐUvUWu uƒuhjv1tvRh+]+}ÐUvU=$%u{ut@1U=$%uSukt@u1hGPY%ÐU=$%uu't@uE jjjPtÉU=$%uut@uE jjjP8ÉUVS=$%uuÃu u ƅukh`5)jj'ÃtSÅthjhjtSjSzCtPks1e[^ÍvUWVSE<vUMQ4,#u,#v}C]{9}~MQh5) jj4ÃtSÅthjMQh j tSjS1e[^_ÐUWVSh@h%ƃu`jjǃtWpDžthjh%h`jG 5WjdW"$%v1эQ|ߋ )v:DA tJyD1ҊB < t< t<#1Ʉt! tv: tBA< u9:t]B1ɊvA< t<"t< t1Ҁ9t!v8"t @B8u QWVhS V[^_UvU<-jh,vUuhh,C =,u!j Pt,,1U WV<-,Ehh,u),jPqEEP5,LPtEjh, @-hD-J-lPh@-j]0󥋅<$ @<Et$0Pj5,P u=5)MQ t&5))t5,^,Et.Pj5,CP t ,jlPj Et5,=<-tjP+,=,u(%,(%,^_UvUWVSE} 1t"8tFj,Pt@ue[^_ÍvU-tPh6h8E-ÉU-tP-ÉUShuh. j h.ƒt.1ۉt%Ej:RV…tBC~ۅut1=$E$E(h u,hu0؋]USEt3PhSe tj StS1ÉU-u -PÉUVSu3Vt Åuu1؍e[^ÍvUWVS} }E81ҋEx1ӍTE@Et Ð;t1ʃ}uMI Mtˋ;t1ʃ}uRE8M1EP}1ҋE\:CMqS1ҍ\:C1E@E8tGv~ ,CMIME4S[1ҍ\FE@E<u:C1MI M9tD~ ,CE@ EM4S1ҍ\FE@ E<u CM QEPpÃtMQu1EPge[^_ÐUvUSE] ڊt: u@Buu :u1&v;Su{Uu {u *%]U8tPvhh58ÉU8tP8ÉU WVSËE=8u=8u };1H58h h` u‹E1`=`#t‰1D @`E}@4 v,t Ft:us:t,uFE}?~F}@D>:t[D5E:t),u}?F}D4G}F€:u؋}D vD>:>E>Ev}}衱8E><~2~})DPE uStf8rFlAoMtHaSt|vuTt<hTtJeWt0kWtXnH uH iH ]H QH EH  9H @-H >!H S1EE;t }?}uE=Hf1ɋE0Et1=)}]EDPt LJCEEu߀}-` QM}+UM)U};}HfL8uuFE1ɋ}t')E}DWtLBCE;uE0,t<` 0QM}+UM)U};}HfL8uuF}E}AHE@fDfD@e[^_UWVSt|tv1ۃ8toUR4t C<u<tJ1ۋw>t@4U R0t"O΋UuBtC<uˋG<uDžoe[^_UWVSuu 8Ã{EPE@UR/tVhhpS2ރV+ajj'ÃtSÅthjVhj tSjS~ 6j?WM qV u!hhPVVhh8WsjjwÃtS8ÅthjSM 1Vh jtSj/S Wkjd[^_ÐUvUWVS]uƒt\:/tCR8PvE PR…t71hRƒuphRƃuYVLv8&1D E PS[…tVhS uV1,[^_Ujuh UvUj@$<%ÐU WVSu] t91҉RA$SVhfW V^$ǃj=W…u W)1ۋ8%<%E9s`VM4Wƒ u<%E =ttC<%E;8%r‹8%9sM4<%<M<8%8%uh@P5<%ƒt<%9)u)<%+hl5) 8%8%<%4#8%<%e[^_ÐUWVSDž}E 1Ij=Rƅu?P@hhPE 0P@%=@%tn1IQRE 0oƒ t;u҃;t9E )RPPb E +0PhvjE 0\ME }[^_ÐUWVS5)u>ta@%=@%tJ;1IQ36ƒ u>tvB:u ;u>uu>tpx%=x%tZ;1IQ36Kƒ u.j/6t>tvB:u ;u>ue[^_UvUWVS}]jhƃ|ojEPV~jSVut 1@~fj u CP CPjMQV0jSVwVe[^_ÐUS]fCft)f9|${tEPqCC;E v1]ÐUWVS}u jh9Ã|tjEPSjVSuKVot S*1?}u,}fEjMQSQjEPSSe[^_ÍvUWVS]ڃ;t}CPhƍPzC)‰Ѓ=3~=Q~ VPhWCPWڃ;~PPh t[^_ÐUShMt)hPÃthuSS]ÐUvU WVSh.ƒt]:/tDRhEpSPRRjS…Љ{hR9ƃu1c1Vh Sh t@1D /u EPERStVk[^_ÐUvUWVS] jǸE.э4)u EPËK~9| |vKυu!URUEuBE}tJ~&SU|CE|9| (vt[t' 9}1e[^_ÐUvUSE ] jj PSpƒu;] tUUEPPu|u1]ÉUjj URu%tPjj$u1ÐUWVS}E ] jj PSƃuQ;] jjÃtSÅth5jWh7j v1'vڃ8ux,tj ,PW uC9w u9v^jjÃt SVÅth5jqWVh`j.tSjOS1e[^_ÉUWVS} 1ۋuF4$hVj # à jjVj5hVj*hVjjVjhVj hVj à VW1 à V ÃG؍e[^_ÐUWVS1󫍍󫍍󫍍󫍵hXhZu"1 vVQv|<#tr< tn1SQhQuAMQQ]tu AuVQQhQT aQu#QQMQQz[^_ÍvUS]hO{t.3t h5)jj[;,uCjhS u&Cjj jP˾B(wnR訾cjhSǾ uCjj jP葾P3jhS藾 u CjjjPa%P3j,S(ÅG]ÐUvU,WVSujh qE @jSQ 9h$SQ =$t 1It ISj uP踿 huP衿 jQQ) ;uh$SQ\ Q譺[^_ÐUvU WVSDžDžh{ h} )Ph VNƒ n1у<1 tPh} h #~=)vQDG tх1h%V萾ǃtAh%j{t(h%jbÃth%jMtPh} h  v+t%-t Ph} h j輺WvDžhE PSƒ t2hEPP}ƒ sP菹8th} h j)1҃t +uЍ[^_ÍvUWVS}1h%u,vh S]t%U RS׉ƃu0h%j ÃuɅtEvh Sth%jڼÃuمtWU Rjqu1e[^_ÉUS%=%uhSo&؋]ÐU&u!hh@腹&@@Puu utÉUWVS}j@wV蜶Åt31U RWt\PCPi?@uU RjV_TU RW^t;Wεƃt*1ۋF 8t v4U R̺tCF <u1e[^_ÐUS]S胺Sh" jv@0蜷]ÍvUWVS]u ;@ujVCPvVSu=;.uA1IMэQ9U~du)VS…uRMh4 Su j.V)1эQ|.uRV PS3t1e[^_ÐUS]h: S蒹tu S肹t1]ÐUvUjzUWVS}h(j荵xh(j{thz XƃtIh V謹Ãt55)`PS`uShS]SWƷ5)15)hSuǃ 9tj腸j W蜳ƅujlvF t tDž`]K9`}*)ڃtFE `>DžpDž|lhvh |u1S@Ãtsj=S蟲t h@1уQuNjh8SpRBph Wh||hlQ|P)xRj tQjP[^_ÐUvU\WSh  h 赲Ãt]1уQ Sh WWEPWjƒ t}tE9E~WzPWrh EÃt>EPSj蠳 t}u h vE9E~h h e[_ÐUvU Shs tzh PS/ E@h P)Ãt*5)P蠵SguS虴1h} P u5)臱ÐUvUVS`E`URdlp'j薲ƸE.M)ht|x؍e[^ÐUvUVS]u jSj覵 t jwv;t N~C׍ve[^ÐUdWVS]u%E j MMQSM QVMQj/MQ1t@jj jP:Džu%1Ҿ&1&9=&t&tB9<0utE]Sj踴MMME% EESjjM Qkt,M QMQx%Puw%v1e[^_ÐUvUVSuv uXhV jj薯Ãt!SWÅth] jrv6v h` j+cv 6Zurh 舮jj,ÃtSÅth] j6h jƯ tSjS聲 91e[^ÍvUVSuv$tuh jj藮ÃtSXÅth] js6vh j/tSjPS 袰v1e[^ÍvUS]S[|@} t+h tPt h :S|1]ÐUvUWVS] u1҉R!VShw WұWEPWe[^_ÉU WVSh} uOvj Sدƒڀtn)vDC tB:u tI#tDv=tB t DC t=uBRVVhWݭà 9PV[^_ÐUVSuv踭h th 葭vh 5)r jjÃt!SǮÅth jv6vh j蛬tSj輫SV jvhFH'vh%Ft8u FJ'J'Ph*u~u0;PjuDPH6hW<6h\0hd tPvhn5 hvt6PhntPv6hh hBtP5e[^ÐUvUWVSE }uju%UR/PhhS<؃5<%jPURUPNj7URhhS7 SWjpUvUVSuF8/txPhRMjjѩÃt S蒬Åthoj譩6vhjgtSj舩S" ګjvPʪv+txvh跫jj;ÃtSÅthoj6vhjөtSjS莬 FjOve[^ÐUvU`WVShv6h{9ÃjShSvǃu S跧M#tDj VצtSRhV褫uSMQ"tWh VO uW蒦!WEPhvWd[^_ÐUvUWShu螫ÃtSh hը u.h ƒt:/uRh61D tSΩe[_ÐUvUuj˨ÐUvUWVS襥Ψ9Zuztz(t fڃڃv …uׅt `v}thjjɤƃuhjߩvjhV/ u E`f $j Vh( +1Ӄv +HjRhH LLOGIfPNhte[^_ÍvUf j uhL蝩 ht谦{h 蜧h h蝤ÐUvUS]StShV5)觤j 谨]ÍvUW}W1QR‹}UvUWVSU1IvTRP蕩vWBۃP0ǃtWSpƃ9~υ}h5)輣DžhPSbSh5)t `v19}Pv9tC9|9|9s^PWƒt=@މhjçÃ^u1W"WVE[^_ÐUSX'=X'tЃ;u]ÍvUÐUS[[37] $Package: shadow $ $Version: 19990607 $ $Id: login.c,v 1.15 1999/06/07 16:40:45 marekm Exp $usage: %s [-p] [name] %s [-p] [-h host] [-f name] %s [-p] -r host ERASECHARKILLCHARInvalid login time NOLOGINS_FILEr System closed for routine maintenance [Disconnect bypassed -- root login allowed.] LANGTZENV_TZHZENV_HZ Login timed out after %d seconds. d:f:h:pr:%s: permission denied REMOTEHOSTloginUMASKULIMITTERM on `%.100s' from `%.200s' on `%.100s'LOGIN_TIMEOUTFAIL_DELAYLOGIN_RETRIES %s login: !xCno shadow password for `%s'%s NO_PASSWORD_CONSOLELOG_UNKFAIL_ENABUNKNOWNinvalid password for `%s'%s DIALUPS_CHECK_ENAB/bin/shinvalid dialup password for `%s' on `%s' ILLEGAL ROOT LOGIN%s LOGIN `%s' REFUSED%s FAILLOG_ENABexceeded failure limit for `%s'%s FTMP_FILEREPEATED login failures%s Login incorrectPORTTIME_CHECKS_ENABinvalid login time for `%s'%s IFSIFS= LASTLOG_ENABHUSHLOGIN=FALSEWarning: login re-enabled after temporary lockout. login `%s' re-enabled after temporary lockout (%d failures). %a %b %e %H:%M:%S %z %YLast login: %s on %s from %.*s. HUSHLOGIN=TRUETTYTYPE_FILEROOT LOGIN%s LOG_OK_LOGINS`%s' logged in%s FAKE_SHELL͠ȠTȠȠȠȠȠȠȠȠLȠ$Id: dialchk.c,v 1.5 1998/12/28 20:34:34 marekm Exp $Dialup Password:$Id: dialup.c,v 1.3 1997/12/07 23:26:50 marekm Exp $r/etc/d_passwd*/etc/dialups%s:%s $Id: encrypt.c,v 1.6 1999/03/07 19:14:35 marekm Exp $crypt$Id: getdef.c,v 1.12 1999/03/07 19:14:36 marekm Exp $USERDEL_CMDUMASKULIMITUID_MINUID_MAXTTYTYPE_FILETTYPERMTTYGROUPSYSLOG_SU_ENABSYSLOG_SG_ENABSU_WHEEL_ONLYSU_NAMESULOG_FILEQUOTAS_ENABQMAIL_DIRPORTTIME_CHECKS_ENABPASS_WARN_AGEPASS_MIN_LENPASS_MIN_DAYSPASS_MAX_LENPASS_MAX_DAYSPASS_CHANGE_TRIESPASS_ALWAYS_WARNOBSCURE_CHECKS_ENABNO_PASSWORD_CONSOLENOLOGIN_STRNOLOGINS_FILEMOTD_FILEMD5_CRYPT_ENABMAIL_FILEMAIL_DIRMAIL_CHECK_ENABLOG_UNKFAIL_ENABLOG_OK_LOGINSLOGIN_TIMEOUTLOGIN_STRINGLOGIN_RETRIESLASTLOG_ENABKILLCHARISSUE_FILEHUSHLOGIN_FILEGID_MINGID_MAXFTMP_FILEFAKE_SHELLFAIL_DELAYFAILLOG_ENABERASECHARENV_TZENV_SUPATHENV_PATHENV_HZENVIRON_FILEDIALUPS_CHECK_ENABDEFAULT_HOMECREATE_HOMECRACKLIB_DICTPATHCONSOLE_GROUPSCONSOLECHFN_RESTRICTCHFN_AUTHyesCould not allocate space for config info. Ccould not allocate space for config infoconfiguration error - unknown item '%s' (notify administrator) unknown configuration item `%s'rcannot open login definitions %s [%m] " "$Id: getpass.c,v 1.9 1999/06/07 16:40:44 marekm Exp $r/dev/tty$Id: gshadow.c,v 1.6 1998/04/02 21:51:43 marekm Exp $r/etc/gshadow$Id: port.c,v 1.3 1997/12/07 23:26:54 marekm Exp $r/etc/porttime*$Id: pwauth.c,v 1.9 1998/12/28 20:34:38 marekm Exp $Password: LOGIN_STRING$Id: fputsx.c,v 1.5 1999/06/07 16:40:44 marekm Exp $$Id: age.c,v 1.6 1998/12/28 20:34:42 marekm Exp $Your password has expired.Your password is inactive.Your login has expired. Contact the system administrator. Choose a new password. /usr/bin/passwdCan't execute /usr/bin/passwdforkYour password will expire in %ld days. Your password will expire tomorrow. Your password will expire today. $Id: basename.c,v 1.2 1997/12/07 23:27:00 marekm Exp $$Id: chowntty.c,v 1.7 1998/12/28 20:34:43 marekm Exp $TTYGROUP/dev/%sCunable to determine TTY name, got %s TTYPERMUnable to change tty %sunable to change tty `%s' for user `%s' $Id: console.c,v 1.5 1998/12/28 20:34:44 marekm Exp $:rCONSOLE$Id: env.c,v 1.9 1999/03/07 19:14:38 marekm Exp $SHLIB_PATH=SHELL=PATH=NLSPATH=MAIL=LIBPATH=LD_KRB_CONF=IFS=HOME=ENV=BASH_ENV=_RLD_=LC_LANGUAGE=LANG=%s=%sEnvironment overflow L%dYou may not change $%s $Id: failure.c,v 1.6 1998/12/28 20:34:46 marekm Exp $/var/log/faillog%Y%A %T%Tfailuresfailure%d %s since last login. Last was %s on %s. FTMP_FILE$Id: hushed.c,v 1.3 1997/12/07 23:27:05 marekm Exp $HUSHLOGIN_FILE/r$Id: isexpired.c,v 1.7 1997/12/07 23:27:05 marekm Exp $x$Id: limits.c,v 1.9 1999/03/07 19:14:39 marekm Exp $CNo logins allowed for `%s' Too many logins (max %d) for %s 4pP\|Fh4pP\|Fhr/etc/limits%s%[ACDFMNRSTULPacdfmnrstulp0-9 -]*QUOTAS_ENABToo many logins. pri=ulimit=umask=$Id: log.c,v 1.5 1998/04/16 19:57:44 marekm Exp $/var/log/lastlog$Id: login_access.c,v 1.6 1998/01/29 23:22:34 marekm Exp $r/etc/login.access%s: line %d: missing newline or line too long%s: line %d: bad field count%s: line %d: bad first fieldcannot open %s: %mEXCEPT%s - unknown hostLOCALALL$Id: loginprompt.c,v 1.5 1998/04/16 19:57:44 marekm Exp $ISSUE_FILEr ,L%d=%s$Id: mail.c,v 1.7 1998/12/28 20:34:49 marekm Exp $MAIL_CHECK_ENABMAILDIR%s/newYou have new mail.MAILNo mail.You have mail.$Id: motd.c,v 1.3 1997/12/07 23:27:07 marekm Exp $MOTD_FILE:r$Id: pwd2spwd.c,v 1.3 1997/12/07 23:27:07 marekm Exp $$Id: rlogin.c,v 1.4 1997/12/14 20:07:20 marekm Exp $$Id: setugid.c,v 1.6 1998/07/23 22:13:16 marekm Exp $setgidCbad group ID `%d' for user `%s': %m initgroupsinitgroups failed for user `%s': %m setuidbad user ID `%d' for user `%s': %m CONSOLE_GROUPSWarning: add_groups$Id: setupenv.c,v 1.9 1999/03/07 19:14:41 marekm Exp $%s/%srDEFAULT_HOME/Unable to cd to "%s" Cunable to cd to `%s' for user `%s' No directory, logging in with HOME=/HOMESHELLENV_SUPATHENV_PATHPATH=/bin:/usr/binUSERLOGNAMEQMAIL_DIRMAILDIRMAIL_DIRMAILMAIL_FILE/var/spool/mailENVIRON_FILE$Id: shell.c,v 1.7 1998/12/28 20:34:53 marekm Exp $-%sCannot execute %s$Id: sub.c,v 1.6 1999/03/07 19:14:43 marekm Exp $Invalid root directory "%s" Cinvalid root `%s' for user `%s' Can't change root directory to "%s" no subsystem root `%s' for user `%s' $Id: ttytype.c,v 1.5 1997/12/07 23:27:10 marekm Exp $TERMTTYTYPE_FILEr%s %s$Id: tz.c,v 1.4 1998/01/29 23:22:36 marekm Exp $rENV_TZTZ=CST6CDT$Id: ulimit.c,v 1.2 1997/12/07 23:27:11 marekm Exp $$Id: utmp.c,v 1.8 1999/06/07 16:40:44 marekm Exp $No utmp entry. You must exec "login" from the lowest level "sh"Unable to determine your tty name./dev/LOGIN/var/log/wtmp$Id: xmalloc.c,v 1.3 1998/12/28 20:34:56 marekm Exp $malloc(%d) failed $Id: addgrps.c,v 1.4 1998/12/28 20:34:41 marekm Exp $,:Warning: unknown group %s Warning: too many groups d'/bin/sh=/'~tldUJA4& n]K=0"wohbV/etc/login.defsKA<61'# `VR:, 2Kn,X   `  %K//bin/sh,)br•ҕ"2BRbr–Җ"2BRbr—җ"2BRbr˜Ҙ"2BRbr™ҙ"2BRbršҚ"2BRbr›қ"$  (  h'ht@o$oo4GCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)01.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.bss.comment.note# 1((l7 ? Go44To$$Pc ttl ||8u h ~/LL,,Wt  t #T T'TX'X`'`h'h,),)   4ǦELF(44 (444ԬԬԬ<<4hh>h> /lib/ld-linux.so.2GNUCF*854=)+"(6?1>7<,A3 B9 2 !%E: C0@'.-D#; &$/ !!",="2ȏ)9$?@+LU4?_HfXbxh~؏@=""؍,0?Ȏ:"."8?87"ؐ2,?  0 !'H\08G8$O؎"g ?C$?(?4,?0?4? 8??>'> >> >2>> >B$>,(>,>00>94>>8>E<>@>D>H>)L>&P>T>1X>5\>`>US[trs]5x=%|=%=h%=h%=h%=h%=h %=h(%=h0%=h8p%=h@`%=hHP%=hP@%=hX0%=h` %=hh%=hp%=hx%=h%=h%=h%=h%=h%=h%=h%=hp%=h`%=hP%=h@%=h0%=h %=h%=h%=h%>h%>h%>h% >h%>h %>h(%>h0%>h8p% >h@`%$>hHP%(>hP@%,>hX0%0>h` %4>%8>%<>%>%>%>%>%>%>%>%>p%>`1^ոݍϳճ󸿒O=<u8P<С<8u؎t h`=R<ÉUÍvUth@?h`=1ÍvUÐUWVS] S KM)~s9uK(UC!‰S K)ʋs)9~s C C5$?u1ۃ9}u6hC9|5$?he[^_ÐUWVS}] Ahjhhzh x@h@l@@jQ@SWƃ =@tGhhT=tu vPh8j0=|@t j5=4@t z)1ҡ@v?=@t6=@@u-=D@u$=0@u=$@u=<@u =4@tt@=,@t<=@u3hxhȎjjh@'hxhȎjjh@(?dh0*,G?@h9}-h@3Fhj3F9|=h@t.=H@thjhu jh=@th=H@ujh=@tB =@$?P;Prj P @@@b@t\{uRl@FC@s3V3S Ct PCS:l@@Åu=,@tF=@u=h@hMh@h>5\@3@4"h &=4@th<(*h<*55x@vU WVS}X@T=t t1kvta@ @jj?Djqt@X@ @X@ wv@A@@ @$@0@<@@@D@H@L@P@T@hF>Ãth"S2ƃ| Vj>h(@jhTP:p@PhbÃ;t|jEPjjSDuE~= p@PSBP`?t 0?9d?t#jhjl ‰`?0?d?Rjj ]ShTj tfCft Cp@d@hhÃjEPjjSCuE|= d@mvSAPh?t 0?9l?t#jhj ‰h?0?l?Rjj-x$L@P@vj@@vH@L@P@@=@ujFt@$@4@W(@G(@7<@'(@@@ @@Av0@X@@$@@@qv@_jEPjj58?{AuE~=~V58??Pp?t 0?9t?t#jhLjQ ‰p?0?t?RjjEp@@P@L@vhc hf @{,@k0@[58?Q G@@;jjD@@ jEPjj58?'@uE| =e58?W>Px?t 0?9|?t#jhjj ‰x?0?|?RjjE v@o@_@Oh58?h-ƃ}QV58??t 0?9?t#jhjR ‰?0??R-jL+@h58?,ƃ}QV58??t 0?9?t#jhj ‰?0??R;-j*@Vh058?p,ƃ}QV58??t 0?9?t#jhjZ ‰?0??R,jT*@8?toh0P+ƃ|}QV58??t 0?9?t#jhj ‰?0??R?,j)41ۃtujt4@0d@!vh58?8+ƃ}QV58??t 0?9?t#jhj' ‰?0??R+j!)50@vh"58?*ƃ}QV58??t 0?9?t#jhj ‰?0??R+j(Vj"6/X@"h(@j58?n2 jm(jhh M QWj5\@0@t.ÁtvjP5\@5 C;uj;5`@jj:P5w C }?u FEzM1M tEe[^_ÍvUWVSh E8EMMfE??EP88@E t vE*t <b:u[@Ej18EP=MA P=EEAjEPEPN MiXEEFE>E'EE<=1=(tY(E<3MQqu.E<jEPEP M|EG;uMQe6P?t 0?9?t#jh j ‰?0??RjjDvEE<=u0EMA jEPEP MA| }y?t 0?9?t#jh jp ‰?0??Rjj58@P=t؋[Pmu4@e[^_UWVS]} j 5ơ@F5@S'6tW6F vFe[^_ÐU0WVSuEEVÃu&V5Ph 7j9x@#W6tVjG PEU؃ SǃuS t'V4Ph q0jx@ =D@tjVa =D@u =l@ ,@tj=@u!5$?h @ ,@t<=@u3@O A;GvjWO jh@Q G 5`@M uQ5$?=@ =,@t?=@u6@O A@;GvjWeO vjSQ G 5$?h @ @t =$@)=,@t u5$?h @ ?t 0?9?t%jh jk ‰?0??щ5$?WF1 @I @ $?Y;Yrj Q v A@5(@hUREԋURP$ǃ5$?W1 @I @ $?Y;Yr j QA A@=@t~ =@t% $?Y;Yr j Q A@e[^_US]j22‰T@BT@]ÍvUWVS}T@tw jV3 t3[u=P@u .u=L@t tڃ .t1e[^_ÉUVS1;5@}71ۍv?4?D\t PlF;5@|@ @e[^ÍvUWVSu@|;?u;?| MS5?)1‰?@|?| IMD\@@E D`@[]Dd} u =t@M9/t>u ]tB}1҉эT )ԉt]SVtP3 =@@t1 @ IMɋ?TRtPjƒ }n @ IMɋ?TRtPjƒ }=tQU/Rh  2jux@$@|ދ?׍[E \} u=@t =4@p4vu/tj/EPǃu V ,Cv+}}1]C)MEP+ǃSEPW* VSne[^_UWVS}1BU@HE @Mɍv?DhH} t4?<?/tM9ut\WK1ҋETR*Ƌ ?4EPV ?t\VV?|hu 4ÔM?EE@9]}>1Ƿ5?}ElE±E9|̋e[ñ峧]/ӧX;.C <.u {u1]ÉU@$@t r(tCY=@t d=@t Բ=@t|xDqv=@t`XLQ=@tԴ@t9=@t(!=@t8$ vPjl5@5?ÉUS]M QLCL9| %u 13]ÐUSM] QLCL9| %u 13Z]ÐUS]M QDCD9| %u 13"]ÐUSM] QDCD9| %u 13]ÐUS]M Q$?P;Prj P @@lC;@|e[^ÐUWVSHDžD]SUBP}E @t rt&URLE@DLURUB$PB$R(484%PhvV9 (@|QjtRE@0RPEQhV 1эtLRǃtq8vDD$)ĉ+HVHRSvމH W@PHD)JRV%(t F=At L}ajjPPș؃RPa01I40Rh+4y1QhV((jjPPșRPQSh[V$1эt=,@t&=@u5$?h @v5$?HR+H5@h@Epdp0*UzhuJz\tX5$?hT@jEPdJRp`p\=0@tEp`=0@t Urh[^_ÐU WVS}Wj} Wh Sƃw*VF$)ĉ}Wj} WRW=X@t%19s4?DP@u?AC9ruVjW[^_ÐUVSu]=4@tuu V tA=,@t8=@u/S B;CvjS`S jh@R C 5\@V5$?@ t?=,@t6=@u-C @;Cv jSjVs - C =4@te[^ÐU=<th<h<h<h<U$S]=<@t$jjEPC1RPPjh[ =$@t.5(@hEPC8RPP5 @h[a jsds3s=0@ts]ÉUVSu@u($?P;Prj/P/@@u($?P;Prj@P@@@u($?P;Prj|P|@@u($?P;Prj=P=@@u4=0@u+It#$?P;Pr j*PF*@@e[^ÐUWVSM Uu=<=t 1۾ ˁ@ubuu=D=t E>u.u`u  u u It 1ۃuD}1эy}P=t%9wRsE)P t[uh</tS v<Rh< e[^_ÐUVSEp~1vF$?J;Jr%PRBKҍe[^ÍvUVSu=<@%=$@tC @5\@j6jjË0@tEEUĉEU9}u 9u}EURPWV%/EUMMș}EыEE}UJEURPWV-Ɖ׋UU;]}]ЉU]9]}ME9}DME!UwVu wOEE~E@E} u Ew#u wMU0EHE.EE왉EUM]wuv E@ I}~BE9u09u,}w&U!EH0HE.vMjj WV-Ӏ0U jj WVT,ӉΉ߉u }uŋEe[^_ÉUVS]u u2hT!舼Ãuh_!ut ^Uh,!S!| L!9ho!EPjEPS u#E8tE} 1e[^ÐUS]uSL} trt_[vS$At 0?9(At#jh!j肽 ‰$A0?(ARh!S,At 0?90At#jh!j: ‰,A0?0ARh!BS4At 0?98At#jh!j ‰4A0?8ARh!jj蒽]ÐUWVS}EM1e[^_UWVS] uƅt v1e[^_ÉUWVS] uwƅt v1e[^_ÉUVSuUJt3щ] v4?DPt ?vKIu׉e[^ÉUVSuUJt3щ] v4?DPt ,?vKIu׉e[^ÉU8WVSE@EuU RUuQu}+]̍E̍))ˉٸQ}}+]̍E̍})Um+]])M)]+u}+ME+EЉE̍ыE @EԋEP+UщM̍IE̋U RUЋUB+EЋU̍ЉUe)UE @EȋEP+UȋEEe)E̋U U܋U+E܋U̍ ȍe[^_ÐUWVSE@<Dž4U0Dž8 ~<1u Dž< M,<Dž(Dž DžDž1%t94C;] s0t0A0v4,,0t#t2-t3v^t_u&,(Dž봿뭐,1FЃ w5Dž tVЉ ,,1FЃ v֋,EtOu,,1v1ۃz$( y14t0;u a0~0(0uSj00R vSj 0Q 0,0 v^tDžDž y14t1;u 0l ~0(0uSj00P vSj 0RI 0MItjE'R0Qt'jE'R0Q@VvjE'R0Q/VE@tDžDž Try `%s --help' for more information. Usage: %s [OPTION]... [FILE]... List information about the FILEs (the current directory by default). Sort entries alphabetically if none of -cftuSUX nor --sort. -a, --all do not hide entries starting with . -A, --almost-all do not list implied . and .. -b, --escape print octal escapes for nongraphic characters --block-size=SIZE use SIZE-byte blocks -B, --ignore-backups do not list implied entries ending with ~ -c sort by change time; with -l: show ctime -C list entries by columns --color[=WHEN] control whether color is used to distinguish file types. WHEN may be `never', `always', or `auto' -d, --directory list directory entries instead of contents -D, --dired generate output designed for Emacs' dired mode -f do not sort, enable -aU, disable -lst -F, --classify append indicator (one of */=@|) to entries --format=WORD across -x, commas -m, horizontal -x, long -l, single-column -1, verbose -l, vertical -C --full-time list both full date and full time -g (ignored) -G, --no-group inhibit display of group information -h, --human-readable print sizes in human readable format (e.g., 1K 234M 2G) -H, --si likewise, but use powers of 1000 not 1024 --indicator-style=WORD append indicator with style WORD to entry names: none (default), classify (-F), file-type (-p) -i, --inode print index number of each file -I, --ignore=PATTERN do not list implied entries matching shell PATTERN -k, --kilobytes like --block-size=1024 -l use a long listing format -L, --dereference list entries pointed to by symbolic links -m fill width with a comma separated list of entries -n, --numeric-uid-gid list numeric UIDs and GIDs instead of names -N, --literal print raw entry names (don't treat e.g. control characters specially) -o use long listing format without group info -p, --file-type append indicator (one of /=@|) to entries -q, --hide-control-chars print ? instead of non graphic characters --show-control-chars show non graphic characters as-is (default) -Q, --quote-name enclose entry names in double quotes --quoting-style=WORD use quoting style WORD for entry names: literal, shell, shell-always, c, escape -r, --reverse reverse order while sorting -R, --recursive list subdirectories recursively -s, --size print size of each file, in blocks -S sort by file size --sort=WORD extension -X, none -U, size -S, time -t, version -v status -c, time -t, atime -u, access -u, use -u --time=WORD show time as WORD instead of modification time: atime, access, use, ctime or status; use specified time as sort key if --sort=time -t sort by modification time -T, --tabsize=COLS assume tab stops at each COLS instead of 8 -u sort by last access time; with -l: show atime -U do not sort; list entries in directory order -v sort by version -w, --width=COLS assume screen width instead of current value -x list entries by lines instead of by columns -X sort alphabetically by entry extension -1 list one file per line --help display this help and exit --version output version information and exit By default, color is not used to distinguish types of files. That is equivalent to using --color=none. Using the --color option without the optional WHEN argument is equivalent to using --color=always. With --color=auto, color codes are output only if standard output is connected to a terminal (tty). Report bugs to .%s: invalid %s `%s' %s: ambiguous %s `%s' write errorkMGTPEZY%.0f%.1f%c%.0f%c?@;!8!sihuman-readableBLOCK_SIZEPOSIXLY_CORRECTeEgGkKmMpPtTyYzZ0block sizeinvalid %s `%s'invalid character following %s `%s'%s `%s' larger than maximum long int<"6")"'" "escapecshell-alwaysshellliteral<<<<<<<<<<<<<<<<<<<<' ,\Dh8PtMemory exhausted%xstrtolxstrtol.c0 <= strtol_base && strtol_base <= 36$(,@D\ $0xstrtoulxstrtol.c0 <= strtol_base && strtol_base <= 36,0H SundayMondayTuesdayWednesdayThursdayFridaySaturdayJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecember%a %b %e %H:%M:%S %Y%m/%d/%y%Y-%m-%dAMPM%H:%M%I:%M:%S %p%H:%M:%STZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZpZZZZZZZZZZZZZZZZZZZZZZZZZZZ@QZxZZZZZZ$<5`,ZZZZZZHdHZ p<ZZ0|@ZHp=h>΍ލ.>N^n~Ύގ.>N^n~Ώޏ.>N^n~ΐސ X (T  t=HHoooGCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)01.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.bss.comment.note# 1((,7 TT`?Go To 0c HH l PP @u   ~XX / ((oĀ+ <Ԭ`=`d=dl=lt=th>h ?   >>^ELF,4L(4 (444!!!X" /lib/ld-linux.so.2GNU%'$ %  &" #! !!l",L2|)9P@+L7"S"XXi:"p\w܈;"$ "<7"`7"\3"\j""T "\̈" ̉,",L>="<;"P|t"f7"l܉"__gmon_start__libc.so.6strcpytextdomainchownprintfstdoutgetopt_longfchdirputs_nl_msg_cat_cntrmallocoptarg__dcgettextchmodfprintf__deregister_frame_infochdiroptindumaskferrorreallocgetcwdfclosesetlocalestderrerror__xstat__errno_locationexitbindtextdomain_IO_stdin_used__libc_start_mainopenstrchrmkdir__register_frame_infoclosefreeGLIBC_2.1GLIBC_2.0ii qii {PTX \ `0#48<"@$D%HLPTX\ ` dhlpt x|! &US[*tw]5(%,%0h%4h%8h%<h%@h %Dh(%Hh0%Lh8p%Ph@`%ThHP%XhP@%\hX0%`h` %dhh%hhp%lhx%ph%th%xh%|h%h%h%h%hp%h`%hP%h@%h0%h %h%h1^PTRhhhQVhU=u8PС8u t hÉUÍvU|thdhÍvUÐUS]tU5|t X9t#jh`j ‰|XR5T} 5t X9t#jhji ‰XRt X9t#jhj& ‰XRt X9t#jh`j ‰XR/SU WVSE1EM hjhhh ijt/ tsgvmtpuZijX \MKt X9t#jhj ‰X jjhhM QMQ]=̳t hhşhӟ`j=ȳt jM9 `uNt X9t#jhjQ ‰XRjjj7jӁ]M}jMQpƃuOMQt X9t#jhj ‰XRjjNuGt X9t#jhjv ‰XRjj VSu ؃`;E=ijt#WjjjMQSM 4 ES`M 4{t``M 4t X9t#jhj ‰XR0jEvt`M 4Wjj`H `;E'MQfUS]5PtFгt X9Գt#jh:j ‰гXԳRjSH 5PtHسt X9ܳt#jh:j ‰سXܳR0S]ÉUj6UWVS]EEEPSjƒ Ej8E1у)̉eSEPEPW Etttu}u}tEtEEvEEEE|PƒttEt E8/uh`}E];/uC;/tExj/WÅ }u}EPWƒEPWjmƒ tXEPhb2j;EP}jj|PJËxP]vE%=@tQEPhjjEPo} jj|PËxPpv1} tEPE P5T }u}tnEPEPWƒ tWEPh2j:EP}jj|PIËxP\}t$ED$e}tXW }KEPh2jEPNjj|PËxPY/C;/vC;/t}u}EPWjgƒ tfE PWtƒtSEPhb2j"EP}gjj|P1ÍEPGEP} tEPE Pjj}t|}tvEPEPWƒ t#EPhĠQ2jEE t6E PW<ƒt#EPhԠ2jJE}t"jj|PbÍEPuv]EPEPƒt#EPh2jE[uE%=@tShjj{v}uo}u}t5EPEPSƒ tSh$0j[EE PSƒtSh0j*EEh[^_ÐUSMt#1 v\A<vu]ÉUWVSuVǃ|I&j Eu UB=BfzfBEj EPEN1EF./usr/share/localefileutilspm:created directory `%s'4.0GNU fileutilsmkdir (%s) %s too few argumentsinvalid mode `%s'virtual memory exhaustedcannot make directory `%s'write error/cannot create directory `%s'`%s' exists but is not a directory%scannot chdir to directory, %scannot chown %scannot chmod %sؗ@@@@@@@@@@@@@@@@@@@@@(@@@ȗܗ.cannot open current directorycannot get current directory from saved working directorycannot return to %s%s%s%sMemory exhausted BRbrˆ҈"2BRbr‰҉"  h(Є` q $Ԇ0oooVGCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)01.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.bss.comment.note# 1((87 ``p?ЄGoVVNTo0c Ԇl ܆(u  ~/,,,, <hhX !"""$$""PP#P#i&m'ELF4]4 (444YYY*tZtt /lib/ld-linux.so.2GNUCME@=9J73' )L# (8?>B CK. <H+4%-052&/G$; !F1 A:6I*D", t)t? EK\S,A[/d<l r(ulS<ܑ!|"@" L"ܐ?0)r<3",|",."\J" 3"̐ "&,V02<D@"J̎$Rl>"W["ou4{#""@"Ll"|܎2"܏($""|"L$ ̏\\""\y")8<9>LP@"UlN"],Cg|H"}:" "<"__gmon_start__libtermcap.so.2_DYNAMIC_GLOBAL_OFFSET_TABLE__init_finitgetenttgetnumtgetflagtgetstrtputsPCtgotolibc.so.6putcharstrcpytextdomainioctlstdoutungetcsigemptyset__ctype_bgetenvmemcpyperrorfeof_nl_msg_cat_cntrmallocisattysiglongjmpsleep__dcgettextfflushsigaddset__sigsetjmpstrrchrwritefprintfkill__deregister_frame_infofseekstdinwaitsignalreadstrncpyrealloc_IO_getcforkexecvre_compfreadtcgetattrfclosesetlocalestderrerror__xstat__errno_locationexitbindtextdomainfopen_IO_putcfileno_IO_stdin_used_exit__libc_start_mainopenre_exectcsetattr__register_frame_infoclosefreesigprocmask_etext_edata__bss_start_endGLIBC_2.1GLIBC_2.0{ii ii p $6( ,04( E#>F$/*D 59C2&1!80';  HA -4 "$B(,0:4=8G<@D@H,L<P%T.X \3`+d)hlUS[[tSC]5x%|%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h%h%hp%h`%hP%h@%h0%h %h%h%h%h%h%h% h%h %h(%h0%h8p% h@`%$hHP%(hP@%,hX0%0h` %4hh%8hp%<hx%@h%Dh%Hh%Lh%Ph%Th%Xh%\hp%`h`%dhP%hh@%lh01^PTRhhQVhP;U=u8P С 8u鸜t h`NÉUÍvU|th8h`ÍvUÐD$h<jPk Ít&'SD$\$Ph[Ðt&D$PRÉD$P2ÉD$hLPÍ'L$T$D$ PRQH Ð& lWVS\$|$D$D$D$D$ D$h jh!h3Xh3D$8PD$8PnD$8Pd D$PWD$PMD$PCh 5( jG+<<H h>Q'( x=( @-u@P͍v+H9/u/D$AD$(\$w9stA@9rD'D$D$9t&0DStD$DBЉD$A9uL$ =R= tCtt!8tt8t t8u  vp=@u*=pt<H<@@D$ ~D$=u{j/Pt @ &P=Pt ,9Tt jh`j P,TPP$Pj 4D$$= ughjh`jhjjj uhjz h`j$PP == t!4P &' D$$Pà t6D$$P SA=ptt= t  t&|$t$j4PD$0PR! =pt L$ |$t4PD$P9&D$ P4PD$,\;D$ P( PuD$,T  =,tojh=,tW,|$t&jD$(PD$0Pe =ptkL$ ev|$t[D$$PD$PJ%Gt&9\}5= u,jh*D$,P\( PuD$0|$ %=pu|$ t(=t= t) &|$=t j= toh=`~ jrh= t4\( Ph= t h<9D$ ~D$ = tD$$P%vD$ P D$(P jh PD$0Phl  \x=\,;d5jSL$1t&E$t&'u@@DBУ@q& ^t&Nt&>t&p2& "& t&$A;[É'XWVSD$ t$hPVju u1 P= tV;1t&D$%=@uPVXt ,9\t#jhj ‰X,\R/F'h VMÃu PV1nVSyt1\&' S  ‰׋D$l8 SPD$@u [^_XÍt&'VSt$Vjj\$ST$ C= =}7=t0t&=Et = tn&'=euYD$P`t ,9dt#jhj{ ‰`,dRV*&jjVb1 [^YÍ'VSt$D$PT$Raà = t|$u =PD$P=u t8 u=`~ j = te D$Ph@  ;`} Se  `;@| =ujhy tN~ =|=Ht, PH PO T$RÃu=  =|t= t T$R S4jh|T$ R(j ƃtc=t=`~ jJ =pt#;5@|= t ; l h[^YÍjj3=huK Pj =(u"hjjhVv'|n&= u]=0tTht ,9lt#jh)ju ‰h,lR-`0hjjÍv'VSjjN\$ShT PPNtfڃ|$tJ1fT$<H =ptB&'B@fFft 1fC@hj[^ .= t" Pj  P~*=`~ Pct&h,jxS\$' PRSƒu[ WVS1ۋt$|$&'С PCRF<%uފFu[^_ÍvWVSgffft$)tRx t&gfff)ڍ)֡ PV0R[^_Y VSgffft$t$|$+\$t S)މD0D[^YÍD$T$DPDST$\$ щЃtzt8!t+A8!t&A8!t!Attt uAA9r I9/t9sACu  vCA8t1[Ít&S\$= tMt&'=`~=` t"=tP `= tpt ,9tt#jh>j ‰p,tRtKSxt ,9|t#jhGj ‰x,|R1'=u) =PhW`= tIt ,9t#jh`j, ‰,R`= tt P= t Phf(h[Ít&'UW V1S@ |$l$W=ƒ= t&'u+@ v@ ]@ ]  u C =tK;5`=uvt,= u# pR`t&K?sv CFt?r;5``t& pt&u ~N uK W uKt&'W P1i u+=t"C^LC|< u@ ]'0DP@tF;5@| =u WBƒ?%@9|~ =Du C19u=%t=t =Dt Cف@ M[^_]ÐS\$=`=t Pj $hvu Pj = u#tP4 `)ډӅ~ Pj K`[ jI=t = t Pj sÍvPÐ PÐVSt$ ^tС PR-Cu)C[^ UWVSt$$Nl$ |$ G=$u'L$ GAL$ PERNt$|L$ T$ HL$ uGuC=Dt:NL$~.?_u}t }u_uGED$ (1ۃ~_u<t <u }_ut+_tL$ML$D$ 'T$GED$ Nt$;\$tY|$ u4u4=Dt'|$~ L$ 9_u?t ?u }_ut ` t&, P5|$ u=Ht u =DuT$ PRpt# 8tdP PHt$H[^_] át,=u#P Pj `Ív'tPuÐXUW1V1S=HuLL$lQG'h"'1'HL$L$L$Q D$P|$.u-PHD$L=H:u TL$D$HLD$:suWL$lQyt&x$'SD$PL$tQ/Ń G=u Pj ijhi= tSt ,9t#jhj ‰,R~h &h= teh{C@)Ã=puK}1jj L$xQzL$|QS)=pe-@EGu @^zR@Gv't-GWv'[D$u\( P*h = th \[^É' WVh` PP =s 4=t 8hƒu $D$PjRh |$ $'t$VhT PP };hh,h<h@[&'1fD$<uhh<1fF@uhh@=<~hht<h ht=@ @P( hP#tphh7hDh#h!h$h'h- h0hh5 h:h=hA }  hDhDuhGhGt $hJhJq u   hMhRL`thUhZ1, uU 8uK `t, u` ,  #' Dt&Dh]hat(hdhitt8uIhlhpy t.jjP j(Ph thshv0hy h~du dhxu xh`4PPyh`$PdP[ `h% ld%= = u%lwv^_ Í&'jD$Pj 't8tntD$D$Y UWV1S1L$ L$t$;l$xv`9~lÀ\uG :s;t$vf `=4tXTPN<< u< `=4tXPTP=u-`jhQt&:tt$=t>P Pj  PV&' Pj  PVp=tj:=8t%t&XP` ``t$ Pt&t;:tt:su+=4tXTP5N\t1F tuu+Àu  &@á\P`\$ t(t#D$P@`+D$;D$N=u-`+t$D$H9|C$t ,9(t#jhj ‰$,(R[^_]YÍ&' UWV\S( D$ ‰tzt8*t-B8*t(B8*t#B tttuBB)¹ȃtzt8(t-@8(t(@8(t#@tttu@@-Z\$T$RD$(|$$uP,t,90jhj ‰,,0'|$8t$$\$+G|$,r+l$$D$)H;D$|$\$;|$W|$(WD$,|$$uQ4t ,98t#jhj ‰4,8Rt&t$$|$+%t#|$+!|$+\u=uw\( PV\( Љуtzt8(t-@8(t(@8(t#@tttu@@)'%&=$ uC<t ,9@t#jhj ‰<,@RЃtzt80t-@80t(@80t#@tttu@@-@f-f1 1ۊf1 f\$1ۊ1 1 1 1Ɋ 1 1 1 ‰\$tzt8"t+B8"t&B8"t!Bttt uBB$&f.&f.Ft&\$t&\$F\$f\$f^\$f\$f^Ftt&'\$N^t&Ѓtzt80t-@80t(@80t#@tttu@@-@PhVF Ѓtzt80t-@80t(@80t#@tttu@@-D$ -|$,<%t)BK:6#*;JL4G92+8=N- <' 5@RP$OH, 1MC7 IF&"3%QE 0/( ȓ!!ؑ",x2)9`@;F/"NH+ZldHk<b sH7"z@X="Ȑ",h:"."tؒ787""=";"=" ;"\;('6="<8$DAMؐ;T"lX7"rxypX7"3"="8h7"ȑj"xh;"x4"x()" "X$: d#h")H6xCFNV(\^"o;"tyh\8"ȏ*="gXl"h;"؏t"(7"Ȓ"__gmon_start__libc.so.6strcpytextdomainchownprintfstdoututimegeteuidgetopt_long__ctype_bgetenvdirnamefchdirmemcpyreadlinkputs__overflow_nl_msg_cat_cntrmallocisattyoptarg__dcgettext_obstack_newchunkrmdirreaddirlchownftruncatelseekabortchmod__lxstatrenamestrrchr_obstack_beginwritefprintf__stpcpymkfifo__deregister_frame_infochdiroptindstdinumaskferrorreadstrncmpstrncpyunlinkrealloc_IO_getcsymlinkopendir__assert_fail__xmknodstrcmpgetcwdeuidaccesssprintf__mempcpyfclosesetlocalestderrerrorobstack_freefflush_unlockedfwrite_unlocked__xstat__errno_locationlinkexit__fxstatbindtextdomainrpmatch_IO_stdin_used__libc_start_mainopenstrchrclosedirmkdir__register_frame_infoclosefreeGLIBC_2.1GLIBC_2.0ii ii `d>hl p*tx)O ,MIP%"#7Q$ +05B=D&'ECH@(G A.K 1$(,04<8!<@ DNH3L4PLTXF\9`Rdhl8pt;x6|/ :?2-US[Wv,tpO]5|%%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h%h%hp%h`%hP%h@%h0%h %h%h%h%h%h% h%h%h %h(%h0% h8p%$h@`%(hHP%,hP@%0hX0%4h` %8hh%<hp%@hx%Dh%Hh%Lh%Ph%Th%Xh%\h%`hp%dh`%hhP%lh@%ph0%th %xh%|h%h%h%h%h%h%h %h(%h0%h8p1^PTRhPhQVhU=<u8P8С88ut hd<ÉUÍvU؏th|hdqÍvUÐUE@@@@ @ÍvUS]CCC CCCCC C$C(C,C0C4C8CDCHC<C@j#5CLCPCTCX]ÐUXS1ۍEPujuE%=@؉؋]ÍvU4WVS]u =@t@jFjdY EPEPMQjVSyẼ%}tMWSt h9t#jhj ‰hRjj9 }߅uV#MATEY5W]S#VjS1ƒBvhhhhuEc5}tJWt h9t#jh,j ‰hR0jo}tEE̍e[^_ÍvUWU1эL 9v?/uO9w9%}UWVS}u ]VuW{WW6jPVAƃuGt h9t#jh?j ‰hRjj MQVWVMQVWÉ؍e[^_ÐUS]tU5 t h9t#jh`jN ‰hR5d  PPt h9t#jhj ‰hR- t h9t#jhj ‰hRt h9t#jhjr ‰hRt h9t#jhj/ ‰hRD5SUdWVS}1M  hjhhqhMMQhaÃtThHEftG%VStewvbtmut; it$^vt7UWEEFEE6E-vE!vtTt jejhh M QW<=t hhh':4j=t jxB99u?t h9tbjh3jN ‰h=vt h9t#jhJj ‰hPh`jjj^tS=2EEj.M t 4ƋxB9~QuMt h9t#jhjr ‰hRjj# x_9}/MQVM t4 ExH x9|҃}t2MQUUE z<u#BLB@ÍvUSMU t(Y v9Zu9BuA9B u u1]ÍvUWVSEEp,UR(>Euk tEPhQj#3 t h9t%jhj# ‰hQjj ];UUjSEP;jSU R;ƃtuI t h9t%jhj ‰hQjjO jEPjUREPURRPEPVWo MEU (Wq1˃;9URL]Ee[^_ÉUtWVSuEEEȉMjMQE}vuNM QMQt h9 t#jhj ‰h RjjBMQhPj/ehhAM Q1E }GM Qt h9t#jhj ‰hRv]SMQj cE؅tE EuVE%=uGSMQjq t M"E%=uEԅ} ;E~EE$)ĉ{u1ۃ}tS>_?u tS{u Bt>9v"jVMQr E1ۅuVWMQ. |qEMQWMQƃ }t݋MQhPKL}tLjh MQ. |MQMQz}!M Qhu0j,EMQ}!M QhD0jEMQ}MQh0jEEe[^_UWVS}] DžDž}$t},t E,U(E|PURCXЉtURh1EURPuU R= uE(1rUtttx=@uP{8uJUR t h9t%jh!j ‰hQjPPU RCXЉtoU RhQ1\9EuP9EuT9E{ }$t%E%=u`%=;t3{E%=`%={`%=tE%=uePU Rj7 uJPURj u/9u!9u9uth{;uY{ uSE PUR t h9$t%jhj ‰ h$Qjjx@`%=@uJE P (t h9,t%jh@j ‰(h,Qj{PtuM9%x@{ {jU RStf`%PU R5  0t h94t%jhj ‰0h4Q5dlXvE P5  8t h9<t%jhj ‰8h<Q5d7u}$%}$tZ`%=@uHU R @t h9Dt%jhj ‰@hDQj `%=@QE Pr%ƃuI Ht h9Lt%jhj ‰HhLQjjK URV}$t? Pt h9Ttdjhj6 ‰PhT=v Xt h9\t%jh j ‰Xh\ыEPU RQjjV v1у)̉VRVPU Rn Q|8tGE P `th9dj jhWj: ‰`hd@ Dž{ `%=@uXjU R hE PtU Rh1 DžE Pctj8t`U R ht h9lt%jhjW ‰hhlQJ0j{t T v{Tt!x@tE PURhG {}x@u[PU R pt h9tt%jhj ‰phtQjjF. E PR E PhQ1/}$tRU REPu<{Ttx@uU REPhH},U,x@EP|RtGEP xth9|jhj ‰xh|bU$ED$EUD$T$ u`%=@pCL!pppRE PtNU R t h9t%jh%j ‰hQ0E P Z{TtU REPh {$t E EtU9U"E9EU(RSV|PWU REP9]{HfU:/&E P"ǃuI t h9t%jhj ‰hQjj 1.)uOمtZPhBj u@PWj u*9u!9u9uWnuGU R th9 jh`j ‰hE PURE Ph1v{tjU REPYU R t h9t%jhjs ‰hQf0Fvtt{t:t@t.tt"sDE PUR xutPSQU RE P t h9t%jhj ‰hQ0xt`tt ttRSOEȋỦRQE PjU R t h9t%jhj ‰hQ0vthhWEP] }PUR t h9t%jhjk ‰hQ^0>v9E PWtMU R t h9t%jh j ‰hQ0{(uċK uMQE P otu { TU R t h9t%jhAjn ‰hQa0DEP t h9t%jh]j# ‰hQjj{0UUPPE Pt\U R t h9t%jhsj ‰hQ0jG{4{(uċK uMQE P) tsKtu{ u\U R t h9t%jhAj ‰hQ0j{4{<tcs@E PkU R th9jhj ‰hv{,u{uxtt@CL!RE P;U R t h9t%jhj ‰hQ0j{4r``E PDU R th9jhjZ ‰hcvthE PRtOE P t h9t%jhj ‰hQ0jd[^_ÍvUEuhhhh y8vhhhh Z@DHvhhhh6ÐUVS]sSh.hhh3vuuVSjjjuu ue[^ÐUXS]EPSjn |h UMQRu.1ShK0jx]ÉUuUMQRu UWVSu] P&ǍP&G7_=  e[^_ÉU塄 @ P~HUWVSMu}E 11TU]t"ڐ] 9u9ru 9zuB 8RuA Q]A ] rzEB ]Z1e[^_ÉUWVS= G9G jW%Nj]UG4EPw%GSW%NjMw= W Uw}~*^vsKQR6WM}uU MQRuWe[^_UWVS] 5H = 1ɡL )9rh`hhnhwn19wB9vuQjW\e[^_UE1u ÍvUUE 9%ÐUVSu ]1ɀ;t" Cʁt11ڐ1Ѝe[^ÐUu uf%ÉUWVSE MU}9wM)ӋMv)ʉUM1RuVQ‹E؍e[^_UWVS   )ȉEȉE}1щMNE\;HvvS5DZDHuXuV]SMQEPhh !VSMQEPRh  }t  E_MQEP5D- FVMQR D19thhXhnhFЍe[^_ÉUEU `ÍvUS1ۍEPuj u:PPu ju%\9EuP9EuT9E؉؋LÍvU$WVSEE=Pt%PhȒhjjh Lt?RGt(h.Ph0{0j2EL A5L)ǃ .u  tܴڃ .tՃ}tG PEPƒu_ ]UUEEE tUG E1эy D; v QVV WSR F F F  9 uN(FV !‰V N)ʋ~)9~~ F FEPjEP ƒ ;UvUEHvh3h)hnh`}}}udjhh`j vEuG, t h90 t#jhj ‰, h0 Rjjh WSEPj }ug4 t h98 t#jhj\ ‰4 h8 Rjj ;^v;^s ^^ SV=LLuah.L;uE8u#h.MPh03jELt?R\t(h.Ph00jGEL}t EP4F9F t  ;Vv;Vs VV RVEe[^_ÉUWVS]1;M 9,yu y jW  CuhhhnhC%=W/P5 CuhhhnhaC%=@u=< t h9@ t`jhjL ‰< h@ ;D t h9H t#jh j ‰D hH P5dM yWDP5 CuhhhnhvC%=@u=L t h9P t`jhGj` ‰L hP ;T t h9X t#jhcj# ‰T hX P5du M ytJWaP\ t h9` t#jhuj ‰\ h` R W_tl8uM 9uZWPd t h9h t#jhjJ ‰d hh R?0jve[^_ÍvUWVSE1ExuKSuPl t h9p t#jhj ‰l hp RjE8uXxux tLjSt=t t h9x tijhj` ‰t hx DExt<| t h9 t#jhj ‰| h ׅt)SP5 W5dExtJSOP t h9 t#jh@j ‰ h R } tEPt vS}cSP t h9 t#jhfj' ‰ h R0j} tEP1эy} U EE; v RVWSv  ~ @; v jVF /F EL ;P vjh@ jEP5L  L 1эA$)ĉeQSEP ËEP9EH  L )hhhnhTwhhhnh + 9shhhnhqߡ )9} WV~ L +H whhhnh@(P )Ѓ}jh@ pL } t,jj}W  t WWah}OSeP t h9 t#jhj ‰ h R0Ex}t= t h9 t+jhj\ ‰ h RSP5  t h9 t#jhj ‰ h R5du 1ExtJSIP t h9 t#jhj ‰ h R Sw8u E8u[Sh.tISP t h9 t#jh@j ‰ h RjFvSvP t h9 t#jhej ‰ h RWjz8Ee[^_ÐUhWVS}} tr738.ucPt .uWxuQ t h9 t#jhj@ ‰ h Rjj/vGuGt OMEP7j uOUWEG U{vM9t8u 75P t h9 t#jhj ‰ h R|0j3qE%=@EPH L )w j0XP5l à }uG t h9 t#jhj ‰ h Rjj A t h9 t#jhj ‰ h RjjE H  L )P5ddP;Prj P\ v @s5dTdP;Prj P( v @5dSMyt] t h9 t#jhj ‰ h RjjiD t vje}@u MytMQW9kvE tj/7P%MQPWËG EEP5l  uhhrhnhP؍e[^_UhȒhjjh %hȒhjjh@  (hȒhHh4j5$l ÐU5l ^  1jP@ 1jP UWVSu1эQTуsʉUЃP_ǃtbVW/} tIW)f8.WPDƒ} utE8BRhSz VWj~SWe[^_ÉU WVSu gEt}E}1эq::t3Z 1эQF9rVSEPAƒ ;U~UEPƒuEP…uE1e[^_ÉUWVS} u1VWuu4<>.u.|7~u'L7 \BABЃ v9~uyt1ۉ؍e[^_ÉUS]t;u0hS}PShjkv]UUЀ:tv8/uP@8uÐUS]5`tFp t h9t t#jh%j ‰p ht RjS 5`>tHx t h9| t#jh%j ‰x h| R0S?]ÉUj6UWVSuj/Vu18/uH9w)xGPpÃu1vWVS؍e[^_ÐUWVS} uEt.VWURCà }8tމ])эvEe[^_ÐUXS1ۍEPujuE%=@؉؋]ÐUE@ÐUE@ ÐUE@ÐUVSE1ۋ@9s.ƍv9tAt vB@u9vӃ9r׉؍e[^ÉUWVS}11ɋG9s!ƃ:tCABt A@u9r;_ u ;Ou1e[^_ÉUWVS]SBS"S&ES5Wh@M Q VhWM QE1RP,$ɉ1RP,$($MQhM Q迾ShM Q谾e[^_UWVSu} vWFЉ‹Ѓ;Frhhhh諾v8u# Åt3WFЃu[u1e[^_USUzu1#vR9svu 9r؋]ÍvUWVS]} sWCЉ‹ ЃC9rhhhh0ʅt9:uruRu9s‹u 9r1e[^_ÐUWVS1ۋ}7;ws5>t#t} v;]sCIu};wr͉؍e[^_ÍvUWVS1U2;rs3>t!tUR3U ҃tG[uU;rrωe[^_ÐUWVS]u 1ɀ;t)1C;uȍe[^_ÉUWVSM 9s1t G4G9r1ЉЍe[^_ÐUS] whhhh svvSt؋]ÐUWVS}} ttj$覼Ãu 1E s PyCPu u SDʼnsS9s@9rC Cu s{ECC ؍e[^_ÉUWVS}7G9sfVU>tOUt&Gt3ЃG C_ [u܋Gt6ЃUGE9rG Ge[^_ÍvUWVSUzt8zt2:;zs+?tt3UBЃ[uU;zrՋU:;zs(v_tsSuU;zrۋUZ tsSüuU2谼UR觼e[^_ÍvUMA t ‹BA j蝺‰ÍvUEU H JP ÉUWVS}u wVGЉ‹Ѓ;_rhhthhȹEtkPVGЃtV3}tFKMt QSQ)'0VGЃtS2}t BCRW= [Cu1e[^_UWVSMyt$} tuvvvM Qǃu 1vuF G M;Nu> Mu VQGЉ‹ЉU;Wrh)hhh@螸KM;]t SWfu>t#W-ƒZM FBV MuG ]nEMu;NCu6yGFGFG F W]e[^_UWVS]u }uhehhhqѷjEPVSt}CE8t1SW…u \2E@BEPBv0C HK Ds9w vu@PPS1e[^_ÍvUS]jEPu S …u1E8uK KЋ]ÐUWVSu 1IM}эyED8P%Ãu1BWEPS= €z/u >/uJ >/t/B}tEE@PVR؍e[^_ÐUS]C=Xt(jhwC} hyv=Xu'Cuh10j1]ÐUWVSu}1ۋ|LP螸tiuPtPE uPhõ0jz%v`}vh蜵0jS؍e[^_US]| PCtP職]U WVSu uEVtEuEPѶ]jvy .u y t[ڃy .tT+U M1)9v%9wVEPƒtG+EÉUEPSZEP脷uEP?ƒuEEP' EP苶1e[^_ÐUWVSRVE&+Ã;"u, VUREVURQǃtȅtEvƋUR1e[^_ÐU`thj5\lÉUSuܳÃu؋]ÍvUSu u蕴Ãu؋]UVS1ۍu# t1C}vulDP u3C5pƒu3V,%x[^ÐUWVSu uÉ1эQуL wVPȵ9wEDe[^_ÐUWVSU EE}1IM1:tPӉEPEP39ƒ u+;1IE9t*}uu vEF;u}u E e[^_ÍvU}uu u5 P5d?ÐUS[s&u ujo]ÐUSh=htЃ;u]ÍvUÐUS[&藴]bfsilSeu]vMVH@versionhelpversion-controlverboseupdatesuffixinteractiveforcebackupcannot move `%s' to a subdirectory of itself, `%s'do_movemv.c((status) == RM_OK || (status) == RM_USER_DECLINED || (status) == RM_ERROR)cannot remove `%s'virtual memory exhaustedTry `%s --help' for more information. Usage: %s [OPTION]... SOURCE DEST or: %s [OPTION]... SOURCE... DIRECTORY Rename SOURCE to DEST, or move SOURCE(s) to DIRECTORY. -b, --backup make backup before removal -f, --force remove existing destinations, never prompt -i, --interactive prompt before overwrite -S, --suffix=SUFFIX override the usual backup suffix -u, --update move only older or brand new non-directories -v, --verbose explain what is being done -V, --version-control=WORD override the usual version control --help display this help and exit --version output version information and exit The backup suffix is ~, unless set with SIMPLE_BACKUP_SUFFIX. The version control may be set with VERSION_CONTROL, values are: t, numbered make numbered backups nil, existing numbered if numbered backups exist, simple otherwise never, simple always make simple backups Report bugs to ./usr/share/localefileutilsSIMPLE_BACKUP_SUFFIXVERSION_CONTROLbfiuvS:V:4.0GNU fileutilsmv (%s) %s missing file argumentsmissing file argument%swhen moving multiple files, last argument must be a directory%svirtual memory exhausted`%s' and `%s' are the same filecannot create regular file `%s'%s: omitting directory%s: cannot overwrite directory with non-directory%s: overwrite `%s', overriding mode %04o? %s: overwrite `%s'? %s: cannot overwrite directorybacking up `%s' would destroy source; `%s' not movedbacking up `%s' would destroy source; `%s' not copiedcannot backup `%s'cannot remove old link to `%s'%s -> %s %s: won't create hard link `%s' to directory `%s'%s: cannot copy cyclic symbolic linkcannot create directory `%s'.%s: can make relative symbolic links only in current directorycannot create link `%s'cannot create fifo `%s'cannot create special file `%s'cannot read symbolic link `%s'cannot create symbolic link `%s'preserving ownership for %s%s: unknown file typepreserving times for %ssetting permissions for %spreserving permissions for %srestoring permissions of %scannot un-backup `%s'valid_optionscopy.cco != ((void *)0)((co->backup_type) == none || (co->backup_type) == simple || (co->backup_type) == numbered_existing || (co->backup_type) == numbered)((co->sparse_mode) == SPARSE_NEVER || (co->sparse_mode) == SPARSE_AUTO || (co->sparse_mode) == SPARSE_ALWAYS)copyvalid_options (options)%sprint_nth_dirremove.cdepth < current_depth ()pop_dirn_lengths > 0top_len >= 2__extension__ ({ struct obstack *__o = (&dir_stack); (unsigned) (__o->next_free - __o->object_base); }) >= top_len__extension__ ({ struct obstack *__o = (&len_stack); (unsigned) (__o->next_free - __o->object_base); }) >= sizeof (size_t)[...]full_filenamestrlen (buf) + 1 == n_bytes_neededfspec_filetype_modefs->have_filetype_mode.%sremove_cwd_entries((status) == RM_OK || (status) == RM_USER_DECLINED || (status) == RM_ERROR)virtual memory exhausted%s: remove write-protected directory `%s'? %s: remove write-protected file `%s'? %s: remove directory `%s'? %s: remove `%s'? removing %s cannot unlink `%s'%s: is a directory%s: directory `%s' is write protected; descend into it anyway? %s: descend into directory `%s'? removing all entries of directory %s cannot change to directory %s..cannot change back to directory %s via `..'%s: remove directory `%s'%s? (might be nonempty)removing the directory itself: %s cannot remove current directory `%s'cannot remove directory `%s'cannot remove `.' or `..'cannot remove `%s'WARNING: Circular directory structure. This almost certainly means that you have a corrupted file system. NOTIFY YOUR SYSTEM MANAGER. The following two directories have the same inode number: continue? rmold_ent != ((void *)0)~..~%d~numberedtexistingnilsimpleneverversion control typewrite error.# entries: %u # buckets: %u # buckets used: %u (%.2f%%) max bucket length: %u Y@hash_lookuphash.cbucket < table->bucket_limithash_get_nextnext_primecandidate >= 10hash_find_entryhash_rehashnew_bucket < new_table->bucket_limithash_insertentry.cannot open current directorycannot get current directory from saved working directorycannot return to %s%s%s%sMemory exhausted%s: invalid %s `%s' %s: ambiguous %s `%s' t^n~Ώޏ.>N^n~ΐސ.>N^n~Αޑ.>N^n~Βޒ.>N^n~Γ  P(  x@،@ohoo‹GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)01.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.bss.comment.note# 1((`7 0? Go‹ Tohh 0c  l  8u ، @ ~/HHؓxKPP__ 44u0dduhhuppuxxu0v``w) `wU}IELF444 (444~/~//8\1 /lib/ld-linux.so.2GNU%/#. ,$+ *)"(- ' ! &% Ԋ)!()1'":DbVed/"l@srz/"4:":"It:"I"ԉ"7="$T"d:ĉ" dD:"D$ t\*;"7)>$H$V]"n4s%zT$Ċ`"tt"!!__gmon_start__libc.so.6printfstdoutstrerrorsnprintf__ctype_b__strtol_internalgetprotobynamegetpidmemcpyperrorgetuidmallocoptargrecvfromgethostbyaddrsocketselectfflush__environalarmwritefprintf__deregister_frame_infosetsockoptoptindsignalstrncpysendtosscanfinet_atongettimeofdaygetoptinet_ntoagethostbynamestderr__errno_locationexitsetbuf_IO_putc_IO_stdin_used__libc_start_mainsetuid__register_frame_infoenviron_environGLIBC_2.0ii $ , %" '!*   #&( +US[K7tvn]5|%%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h%h%hp%h`%hP%h@%h0%h %h%h%h%h%h% h%h1^PTRhh$QVh@U=u8PС8uTt hdRÉUÍvUtthhdAÍvUÐUWVS]} `ȉHh@ hE5$jpjj }4O8uhc5hjPPDžP-$ jj j5hh5gj @}HujPh53j j59jj j5Th5j\ HujPh5j(jj j5Ph5vjv  5Vn a  U Ijj j5L=~h*5ji hH5jI  ƅo jj j5=vPhdjn EPEP|PxPtPhy5t5hFuE9~1E ;uLE9EuAE}ىu0u'hyK}K˃)]]SEPURhh>5j EUEBUUUEUuBUuh#ffPPh Ep hQhME}u5j 5Re[^_ÉUSM U1ۃ~vÃu %ÉҍÉf%]ÍvUSUM AZ)É؉B} @BB)]ÉU VSjj5j 55`h,5thHq5lhba ptQhyIttJ l9~h(1v])MEE șQhè5j el=x\EgfffEE}+u)PVp5|1ø)SVXUEE}+M)PQhBlu jjUS]$ȬhC$h!fh>^h`VhNhFh>hͩ6hީ.h&hh@hjh{hrPh]hJCt t7vtt(hhh h`Phs6PhXhCtt hh$PhsPh CPUhDjGhO^;h`R/huF#h:h. Ph!]UWVS]4{h`CPCPCPP%PhfCRf %Ph(C PC PCPhȭs Phڭ~sPhڭk(PGh߭UN5j e[^_ÐUSujjURZà u!uYPhhh`4!u8P3hhh``]ÍvUS]S C <u$AQPQPh&<u%AQPQPh@W]ÉULWVS} ?t-DPuh5jvC;uԍuuEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPVhW2ǃH~:1ɸ)9-E19}uuUʍvuBC9|;M~u:hl1ۃ9}vu3Ph߭NC9|h"6\>"OD  Tx#Y9h،9nȋh@"Hl"@"؋"H":""@k@k!__gmon_start__libc.so.6longjmpstrcpysys_siglistioctlgeteuidgetenvgetegidexecvegetpidmemcpyexeclreadlinkgetuidmallocisattyoptargreaddirabort__sigsetjmppipe__lxstatwriteenvironstrcat__deregister_frame_infochdirwait3umasksignalreadreallocforkopendirstrcmperrorisdigitaccess__xstat__errno_locationexitatoi_IO_stdin_used_exit__libc_start_mainopenclosedirfcntlsigsetmask__register_frame_infoclosefree__environ_environGLIBC_2.1GLIBC_2.0ii ii i@j@k5h h h h2hh#h3h!hhhh i(i&i iiiii' i$i(i,i-0i14i 8i/tjh;XEuE@}>EPSj |)E%=@uVSPS0|1VW ÃuVh;= e[^_ÐUlWVSu5pkff<>/<y \/CpkEE<.u E;}u$ <x /CM[/CEE}t <y[ÊGC?u}ku=<uV[V5fj }5fh; E%= <y [ f+ <QXEUԃ=pkt1эT RXuSMQƒ}5fh;=pktE/5pkE@PE;/tdU G}/uEu}1҉֍t2VWƋEPVSVvDž <yY f+ <QWá|k@|k;t8S6}+|kH|k|kutkt/Sz|kH|k|kutkt1e[^_ÍvUpku13/tvt @/uu pk @pkÍvUWVS#}1QV‰pkuVRff< >/0U:# <yXËEECu>ދ/<KE;uf9vj<K;/t^E8tR<t? <yX/CE8t$ <yWËEECu>EЭ; <yW/C=<uWlkt R5fUlke[^_ÐU@5lklhBHJȅ} 5lh2lh 1ÉUWVS=lk|k@|kS$} h <jjCjjR EuZS{tjCjsys1jh<h<h(<>j'vsCփ78u/~ލ)PVà ڃtDžREt j|;t~ t h><FR.Slk|kH|k|kutkt[^_ÐUWVSEEu u}tuu6u<¿T<u E uW<EE@E\uڃ}t`uFuFwJ$\<v? ; 7 3 / +1ۺuЃwFuJxMlhBpr}5lhMlhuFuVut4lhBpr}5lhlh uE}u,lhBpr} 5lh迅lh 1e[^_ÐUkuEkjRU|kttk@tk?vtkj=4t=st j hÉUu uhx=ÍvUVSutk|k@|k] tZxktPh=hDh_ SVhDh phBHJȅ}5ph衄ph aje[^ÍvUVS]u =ڃ==t&=9u Bt$ڃ9uSh?j h\k\ke[^ÐUWVSEM Y~zff<q+ <yQ  <yQŠCB;uu <yQ<=f)ljPJOÃSke[^_ÉU VS]uVOjS@7jP,VO jT`=u7VOe[^UWVS]} e$?js=kZSjs=k>=k1*vjs=k=kWs`sjsxWs=X|WSE1js=k=kuWs C tWP5k5kqSeS^YWSALssk2S%jWSKPh?-h0hs =tu=pt=ktu 5kae[^_ÐUVSuk1;> u=k =ktujvkkujvktu k=k kʐ=ku k=k k kke[^ÍvUWVS}UURLuv_t jVS =k[uFkk]tnjsw jwktEu k=k k%=ku! k=kku kURKLe[^_ÍvUWVS]} UURLE@jPss>^t4EpSp/t=ku'Wv [u͋vt =ktURKe[^_UWVS}] ?wjW9EVWR;u tjw#uSwu>||UR<k|kH|k|kutkte[^_ÉUVS]t0uwvjVs E@C [uՍe[^ÉU WVS1ҋMYt vBu|k@|kRMQ8EMYus F;t V}W:h@|MqsMQ9 u~|kH|k|kutkt~jjWxW~|-u~tjjvwvjs| W}v~ |kH|k|kutkt'Myu>|k@|kMQ:k|kH|k|kutkte[^_UWVS}u UURHFFF ?uVjW ]S/} h@jW6EjWR8uP|ktkt.uN{tj>jstvs,jWasEUV UR He[^_ÍvUWVSEPG,0$(MYtTst1!Mt%!MFu>=uj$PSvj,PSe1 [u0(Ep BDž ,tv u Q!F,tKu担Dž=st=ku ~ H )=w Hhy hDhyDh+Dh$t7v Hhy hDhyDh Dhs-yű,t6 Hhy hDhZyDh Dhsxu Hhy hDh&yDh DhhDhy uDžDž sjS1B uE{u? t00K‰SCu uҋMyu6uE t%M u t jEP(3ƋMYE t%P=} h@SMQV24ƒ UE tN|ktkt:W{tjAjswrs/M h(@rQrjEp mjh!hď.ơȑPV 5ȑ$tjsv{u} VRQup|k@|kV0k|kH|k|kugtkt^Wv0h@hDhskhDh sOvuEMq tjPh_@y EPx>[^_ÐUS];u#Cp2gtjEPCp]ÐU5kF{kÍvUS] }~ sbD¡k9~…~!8cu vkk1]ÐU塜k}~ E pD=ktkkUÉU1ÐU}~+sjojȑP{PE P1UWVSuj/U2CtU RUR2h8 Y:Ny-=ku$U RURSR9 ttSv<U2EPÃujWPU2e[^_ÐUWVSu] URSV8 ufEjV"3>;xk 6"l =~8#ux!u3URS&CPzHj[8e[^_ÐU WVS5u=luuu9mu ha@ff< t$ <y<ˆBMx G t u <y<EO<5f)ƉPh:uuMv< t< uGMy}[G JE9Eu^uum@p@E߹׹?E!ÃEtǴھ_M5k@<];/u;u MM'v0'MvQSjG |E E%==ktU1QU4S_2jURǃtڃtSEPh@U S4vCuEI1v+9Eu E@tl9Eu EtXEtN|kB|kjEP"fGw|kJ|k|kujtkta@ZUREPGà t}t"jURQEPh@5phiU G GU ze[^_ÐUVSu9=9t&8uVRuC;uܸe[^UktvB:uȿUkUEktVC P t ]u} tsuo=|kG=|k1у Qr/‹EfCC V{ W|kH|k=|k utktiEk؍e[^_ÍvU|k@|kk Q<|kH|k|kutktÐUVSu |k@|kjuÃڃ{u s9ffCFC|kH|k|kutkte[^ÉUS]|k@|kEu d6EPPSa|kH|k|k utktH]ÍvUjutڃxu p!9ÐUS]  fjjufXl)PRS&i]ÐUWVSUu }B `l`l\l5\lV djM-‰Z`l`lE|k@|kHlPHl|kH|k|kutkt=Hlu`l\lt F`lFe[^_ÉUWVSu} FttPv~Suwt" <xXl .XlXlF <xOXlRWVƃ늉W؃Pt@ٳѰ.@ʋMQ)Hʳ@ٳvuB}X}Ԁ<8 u# <xXl &XlXl <x Xl&‰XlCXl;ut/ <x Eߋ=Xl&‰XlE߈XlӃutt EJEI;tx;EԀ< u# <xXl &XlXl <x Xl%‰XlCXl;uπwӡje[^_U=DluHlj"¡DlDlEBE BEB UWVSMM=DlHlv]_ u MvE@ހ;uCPCMQ)th;uwM9 tNj"‹MJM AQM9 u0$ހ;uCPCMQ^)u vEG9r҉]EG9m?7M9uM9 t1M9Mv)j0"‹M j!"‹MJM AQe[^_ÉUVS] `l=qSB<*t !uQ vB<]t)!u;M t~/u E농vp}u^;=@ltEM AuAG9u}tEP5@lj u5@ltevMu 9ut;MsuAAG;Mr@l9u`AB9u :/ubAGQE;=@ltG/u>u EEuFuEu<.t<~.EuV'Ãtz{ .u}tas uVuVrtJ}tuVW5@l\ *vC S BAuA/uVQtktuV}uuF/e[^_ÉUWS]1QTSWjD‰z`l`le[_ÍvUM1҉ȅt BuRQUWVSE}  rv>hu ǍF|;HyVu)u U RWǍu ދtswo}>>uEe[^_ÐUEU 8!ux!uRP¸) vRPÍvU WVS]u C*t@t9$?tjCF8t!Fu t!?t*t[t F8uVSyFuߊUU!u{1[ÉU#vDPáȌPS5ЌM5ЌЌȌЌvȌЌDȌIy|kH|k|kutkt螾|k@|kCCCfC ~P/Cv[|kH|k|kutkt?؍e[^ÉUWVS}u |k@|kMEu/|kH|k|kutkth BU} 4M4Ќ5ȌNx{t SNyn|kH|k|kutkttw?}uLjAjAtڃ u0=u'jejhB t h B蔽}=sj?j?j?|v}u Mf dtCW GfG Mf fCC@=st=4tt V_C|kH|k|kutktsEe[^_UVSu|k@|k~u+Vju®8 uh5B蟼щV FDu  VUtk|kH|k|kutktʻ؍e[^ÐU WVSu] v/8uSVCEt}#|k@|kE=Ќ}Ȍ9}] {EESU39sWJڃ:t=;EuEf}}{}3fڃu Ev<uE}9r}t }t }9tEEȌЌ9E6|kH|k|kutkt`=4t=st} } 9}EÁE } 9}t}WhMB5phA E?@jt R?PhA5ph@ t hRB>phBxz}5ph?ph hDh? }t}GEe[^_U}%jPu vUVS]j2 Ɖ5Č̌.SČe[^UVSu^$BvvhaBvhdBvhiB6v^sthnBÅuhrBvVhtBvDvhvBv*hzBvhBhBhBvhBmvhBLvhBNv FhB-hB2Fp'hBvhB^t'SrCthBCÅuڋ^ vhBS4[uvB'BBBB19FtV0UffEEPRSIwV 0UE@Pv hBhB e[^ÍvUWVSĚuČuFvu'$B ̌̌~ {B̌>}FQ=}}/E'<w{=̌ v B̌Ǩ؅.B.B.B FQČe[^_ÐUlWVS}t  =MMQr u  v ԑM1;h@EP2ƒ:u@8ux/tçv@VRjӧ }E4E;>~O}uIku6CP9phBHJȅ}5ph:ph Eȉ>C;7MQe[^_Ujj螦DžTjdP=ku*(4DžT&Tt=st =4u j]85=ku<phBHJȅ}5ph9ph hDh9XP|ktktITt|Td k(47XP M QMQ M t28-u-DžThDCDžThQC3=vu =t$hZCؤtDžTP荴DžTt Pq=vu =u j5k6ÐUWVSUUR/1haC:7Gsto=uuftW|k@|k,t P 0,V 0|kH|k|kutkt蜱jVUR=t51ۀ=st"}tCjnjh0h7 Sƃ/=rt 1 URLe[^_US|k@|kjuϤÃ| jS|kH|k|kutkt| j]US]|k@|kjSj| jPw Sh~C|kH|k|kutktPjl]ÍvUS] k}~js{Cxkj/k]ÐU}~E p|k5ku4ÍvU}~5,E p1c|k@|k50 ,0,|kH|k|kutktaj50輱kÐUu艣USuܡÃu hC蕯؋]ÉUSu uaÃu hCj؋]ÍvUWS]1QSWOe[_ÉUVS];f~fށ|k@|kFPC¡fJ f5ff|kH|k|kutkt@f  f)fe[^ÐUUuj hCjߠvf)ffÍvUUffBfBÐUS]|k@|kf;tfR諡f;uCfCf|kH|k|kutktc]ÉUWVS fMMsd=ffB9ui@ta|k@|kfChPR¡fff5f|kH|k|ku/tkt&ƬVËMQSWf5fe[^_ÐUE$f)fÍvUSf f|%~S5fP8K<ff)H<f؋]ÐUS<f)f)ډ<f؋]ÍvUEf)fffM ))‰<UWVSE1pu d vEhCo u؅tj襟tS015|u hCȫjhCe;EuE@EE1ff<UU Et1<  <}t<\u < }tU: uPREt"}\ujURj ]~tVEPUR|tA=<uj5f67Eff<  <yÊECjURjZ E=<uQj5f6jh@P77 uEe[^_U WVS1vhC] u|k@|kj輛V贛|kH|k|kutkt7|1u Er|D(w@]@ux@1 u EruD(w@Mux@1u EruD(w@}u8x@8WQShC/_VhC/RvPt41<vU rhC讨tCuV{ ShC艨1e[^_ÐUS]M U CAtJ]ÐUM U Bu1 v8uÉUS] MUJx ACJy]ÉUSM] tCA8t1 „u]ÉUS]S#uShC詧S,]ÍvUUЃ w B:u1US]tEHDS3DHPLHPS1]ÐUWS]DH$0Dss ss~sjvs sZv{ 1 Ds=s6vs `s&vs 0{1 D s 0s(e[_ÐUS]tHsu]ÍvUVSuu1LUDأLЃ$Dvvv C vCFvCFvpvv `C vUmvv C v=Uvv0Hv $C v1vv DC vvF vv C FCvC؍e[^ÍvUVS]ut*LLs‹P6uEe[^USMPASt vABuP؋]ÐUEtPÐUVS] |}~ S|p={s @={rj|8u=uv=su,=vu#j蜗tj莗ts=tu st={s8u@={r=vu,=u#|xk|jPO|8t|P|xusP%'e[^ÉUWVS}H |F-uVt-~}uywvPxu~Rvv+t|g1Fcu7}t1||t =t hDX WR)Fu}t|0%e[^_ÐUVSuVhDÃu VhEDE pe[^ÉUWVSu1>tvG8uPEvP;uh)=Ue[^_ÐUVSu~t ^ PΔuv躔e[^ÍvUVS}~E p!ƃ9~֡|k@|k)Nx=t 3XNyu|kH|k|kutkt1e[^ÐU}uu j1\v|k@|kj&sP5$|8t PJ|kH|k|kutkt荟1ÐUWVSu }t hE=utupt ;-uC;uF)‰@Ph2Ej ]S>&5y,<-u{tECN8tt:A׀:uA׉8uy:uR ;u,u&PhPE vPh-uF>t|U-u ~u1jF]}:Et!uWhE&vC<:uCڀ{:u*>u|0|u WhnE5d15`e[^_UȄtPs" u tj1UWVS}uh Et1Ð[ tfvtUBw C9vu )vj X@à u # t n EuOUj dXpÃ2=ttj)؍e[^_ÐUWVSUǍvG Ãut %"j xpǃ뺉e[^_UWVSquSj GjÉ_sjo,Cte[^_ÉUWVSEMMďM].A t1$xGjEjuMAt jjQMA@vjC j+Ct jdj Ct=ȏujC C bt jj E=ȏu v MjMAt jj[MAtjz u=u5Bu hNGjWE MA  uz=uq5dGuZu(j CC s( tEMAȏHvȏg|.ȏ[C;ȏ7ȏ&vȏvjjhIS]U WVS]d} JDžDžDž ff<gv=< M  $LH} IP <@d=̏tP }t  <@{Áu! <\@*_ u#=̏LP6t0\t+`t&$t!"u}t <\AL u <@ <AE LE JDž}t <vE IDžev~ <; <Džt? <A xllvG} It=u}u hHtdh/H <Ff)։}uR> u":ud̏vU1NVR jƃ>u9FAÃ>uv&u ~FÃƃEktv|kH|k|kutktne[^_ÉUWVSu]St} hI貁>u.F P1эyWRsM }jjj ukusjjMsjjDsjj;sjj2s$jj &s>uWF ps sv 聣jtsrEe[^_UWVS=Џ1_vڃ;t/u pgVvrڃ;|VPPZr F ~¡|k@|kЏWt|kH|k|kutkte[^_ÐUWVS=Џt.1_vڃ;| PqfF ~?uҍe[^_ÉUSu jusà }r8u؋]ÐU=pg%UÍvUÍvUÍvUÍvUÍvUdUWVS] }.1EUtPShM C?~SUst1 v{]UEvP2Ã|?~U2hM~|k@|kt W}ǃ4Ut PUrU<t S|kH|k|kutkt~EU`1e[^_ÉUSspvt\:tW|k@|kRqt-P7|kH|k|kutkt}r]ÉUWVS}4u >=4<u7t$ t )vt=st=st  u8jWIoEu hM@}}u Ƈ  Ƈ >t9u1Dt t )t EvEh vEURWne[^_ÐUVS] 3<vjSn3e[^ÍvUS]hhS~nu=u |ƃ`]ÉUS=au`@?*<tƀ`k4}k]ÐUS];tj jj]ÐU8jdP1nuBjPnu>dkt8tP}kGUR.oU5lhuÐU5phuÐUVS]u ;t&FHNȅ} VC;uڍe[^ÍvUVSufFڃuFN~u6|k@|kv FF F|kH|k|kNvڃuZ^ |k@|kڍUF PvFV )ډV؉|kH|k|kutktyV&Ne[^Uh0hhDhÍvUS]St.9t(ڃ{|!)PRCP}KCC C]ÍvU|k@|k8htP3m8h4h|kH|k|kutktxUEPu uUE Pu5lhkÐUWVS}u E}ufEfEPu]S7 EPUЅ}SEEEtD7e[^_ÍvUDWVS]E EE r}%t*KMIKEHy SM1vEEEE1E M -uE#uE*uEE@EE /M BЃ w M؍ TJЉUE E JЃ vE 8.uT@E 8*uEMIM@E 8EE JЃ w!vEԍTBЉUE M BЃ vM lu AM ¨҃ $MvUEEȅtEMq vEEpEu}]Eп Pv UEEUMMEtEE@E EMIME}tvNE1MEuNE)ȉẼ}}E}tM 9ou E9E@E1}tBŰM9}UЋ})׃}u(Ox%CEHCMIy SZ Oy݃}t CEHCMIy S1-E)EMxJKMIKEHy S0My#KMIKEHy SF>uOaKMIKEHy S Oy7EMq1}tU1IM̃}| E9~E̋}+}̃}u'Ox$KMIKEHy SB Oy݋Mԅt.>t'CEHCMIy SFMuOCEHCMIy S OynvEE@EKMIKEHySM:M0vKMIKEHyS~M E E M ME e[^_ÍvUWVS}1ۍvVU RURe ~ )ƅ~%E ۅtf8tҸ vC ~)e[^_ÉUWVS} u e8uVWURWgà t؍e[^_ÐUWVSENNt?NNCu6 ‹CC E Mu uBhNt ‹ft OO  e[^_UWVSu U!MBBuDŽ<=u+]tEPShOr SuM 1эT RljMKx vABKy=Bt VRYfEPWe[^_UWVSuVeNjsVCtj=V)VPhOq|k@|ku FPCusCeC$ E Cs=st#t̑u t jq|kH|k|ku4tkt+p$2j ËU Sse[^_ÉUS|k@|k]tjsPu|kH|k|kutktVp]ÐUVSuVt+VsGtC uj=s8@+uր=ztVj=V)Ph!O`p1e[^ÍvUWVSu} kt Vstj=s=uV\t5vVstC uutj=s@u1e[^_UWVS1 ρs!tBt@urP[Ɖs(tBtBure[^_ÐUWVS sbtNCu)CusbCu$Sbts茿Ccދur.e[^_ÉUVS s1tC ush8OAur1e[^U WVSE 8ru EE5k&}|E|(j=}WÃt C:} ~B}W;E0tv}Wvu͋6u}WS}W |E|uE }}7t~v}~tm^;=t6lhBxz}5lhdlhC;=uʋlhBxz}5lh.lh 6uE}h1e[^_ÉU=kuhV9El1ۍEPRjT uXU9EH1ۍEPRjTu7E%="1ۍEPRj^TuE%=؉v]ÉUVSuOu1?C2=Otv3VStك;ue[^ÍvUS1ۍEPujS u!PPu jSu E9E؉؋LUS1ۍEPujfS u!PPu jNSu E9E؉؋LUS1ۍEPujS u:PPu jSu%P9EuT9Eu\9E؉؋LÍvUWVSu]-uN1 |PA< vtVhR`]}-u؍e[^_ÐUSh=htЃ;u]ÍvUÐUS[s/S]TH*4,./p@L.d;;;;;;;;;;};t;n; f; a; [; V; S;M;I;D;=;9;2;,;';%; ;;;; ;;waitunsetumasktrue:trap[testshiftsetvarsetreturnreadpwdlocallcjobsjobidhashgetoptsfalsereadonlyexportexitexecevalecho.chdircdcontinuebreakcommandHOMEHOME not setCDPATHcan't cd to %s..lstat %s failedreadlink %s failed.Pipe call failedpwd/bin/pwdCannot exec /bin/pwd pwd command failed-n-e|dahlptx%s: %s%s: ? ??{?e?[?{?e?[?L?8?'?z??>>>> >C>H>F>t>n>(>s>O\>shared library missingargument list too longsymbolic link loopremote access failednot enough memorytext busyread-only file systemno such device or addressno streams resourcesdisk quota exceededfile system fullfile table overflowis a directorynot founddirectory nonexistentno such fileI/O errorpermission deniedinterruptederror %dNode type = %d pdțț<h؛$$0<|HPipe call failed%s: not found Shell function: builtin command: normal command: _Bad #! lineshashrvbuiltin %sfunction %sbuiltinfunc%s not defined in %s%s: %s %s null or %.*s: parameter %snot set44444444t4444444444444444./sh: turning off NDELAY mode Can't open %sOut of file descriptors[%d] %d %d Exit %dSignal %d (core dumped)%dNo current job%s: ambiguousNo such job: %sCannot fork/dev/nullCan't open /dev/nullwaitforjob: no children%d: - core dumped; && || | ()if ; then ...while until ; do ; donefor in ...case () ... >>>>&<<&<<...??? @@$Php|}-+?=you have mail/etc/profile.profileSHINIT Use "exit" to leave shell. Can't open %sOut of spacestunalloc ep:arg countIFSSu=%s,g=%s,o=%s %.4o Illegal number: %sIllegal number     ,,,4D`hxx 0Pddd  t  efIijnsxzvuBad -c optionIllegal option -%cUsage: getopts optstring var%dOPTINDIllegal option -%c No arg for -%c option OPTARGNo arg for -%c optionFFFFFFFFFFFFFzFsFlFeF`FXFPFJFEF>F:F6F/F(F"esac""case""}""{""done""do""for""until""while""fi""elif""else""then""if"wordredirection"`"";;"")""(""|""||""&&""&"";"newlineend of file@G;G6G1G.G(G"GGGGGG GGesaccase}{donedoforuntilwhilefielifelsethenifA@=}-+?=Bad for loop variableinexpecting "in"(DdIllegal eof marker for << redirectionBad fd numberUnterminated quoted stringMissing '}'Bad substitution  \ , 8 P    , %s unexpected (expecting %s)%s unexpected%s: %d: Syntax error: %s Out of file descriptorscannot open %s: %scannot create %s: %s\ Pipe call failed           %d: %s %s: bad trapSignal system call failed0123456789ABCDEF!$$$$$$$$$$D$!$$$$$$$$$$!$$$x#$!$$! N̑,N,N Nؑ NPS2=> PATH=:/bin:/usr/binMAILPATH=MAIL=IFS= PS1=PS1=$ PS1=# %.*s: is read only%.*s: variable not set%s Not in a functionList assignment not implemented$Id: c_test.c,v 3.3 89/03/27 15:47:25 egisin Exp $?QN^n~΋ދ.>N^n~Όތ  H9(  hhohooGCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)01.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.bss.comment.note# 1((x7 p?GonTohh0c l u h ~ /HH (( H9H9 b hhhhi@j@( @QQlELFċ4Y4 (444TTTp PUPP /lib/ld-linux.so.2GNU%0/(#.% ' "-* & ,)$+! ("3):A4+MW)^$"ct4"{D/ td"!$T[" 3Ċ"ĉ%Dԉ"$  ""D +\3"DTI"Xd:^yd%"ld{t%ԊgH""!__gmon_start__libcrypt.so.1libc.so.6textdomainprintfstdoutgetopt_long__ctype_bmemcpyputs_nl_msg_cat_cntrmallocoptarg__dcgettextputenvabortcallocenvironfprintf__deregister_frame_infooptindstdinmktimestrncmprealloclocaltimetimestrcmpfclosesetlocalestderrerrorstrftime__xstat__errno_locationexitbindtextdomainstimefopengetline_IO_stdin_usedgmtime__libc_start_mainstrchr__ctype_tolower__register_frame_infofree__environ_environGLIBC_2.1GLIBC_2.0ii ii L+ .  *,&! $ # ) $(, 0"48(<-@%DHUS[K[t2j+]5%%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h% h%h%h%h%h% hp%$h`%(hP%,h@%0h0%4h %8h%<h%@h%Dh%Hh1^PTRh(hdQVhU=u8PС8uTt h2ÉUÍvU帴th$haÍvUÐUWVSMuAuH<t 9@t#jhqj ‰<@U=4vhMQǃuMQh+0jEE1MMMMvWMQMQà juugE| uDEPDt 9Ht#jhj ‰DHRjj ovPM QZWbuMQA0j EtPe[^_ÉUpWVS]1E1EEM thjhhRhftC!RtTdtst? rt vut?m5n Mc MWJ M:h$thɶjj jjhhM QS(=thڶh߶hj=t j+ ]%}t@Ã}tC~NLt 9Pt#jhj ‰LPRjjjtRtNTt 9Xt#jh`j> ‰TXRjjj}~N\t 9`t#jhj ‰\`Rjj+jtute}u_ M 8+tOPdt 9ht#jhj} ‰dhRjjjtu}t+}u M @v1PMQ@EE}u+ M 8+tV2!E1ۃlt 9pt#jhSj ‰lp֍EP}tVd}t:EPMQj tMQh]*0jEEjVE}u M C1ۃ}uHVtt 9xt#jh`j ‰txRjj3t]EPuL|t 9t#jhrj ‰|RK0j uSn58uLt 9t#jhj+ ‰R0jg MQ vUWVSu11E P_Eu)=t=t)"ø>uh۸]Av;t(WS!URVWSrtShݸ Se[^_ÉUS]tU5tt 9t#jhj ‰R5  tPPt 9t#jh@j ‰Ri t 9t#jhj ‰R&t 9t#jhj> ‰Rt 9t#jhj ‰RSUWVSpDP@Dž<1DžHx|nLDžLLf:DD9L@4D)LLLC<'~8hr 1tDR1@P%: v<'~ Dž<'<ƒ)ԉD4]VQDPW< )ԉ@S4P@R,DtL@tT 9Le0 |u . |Dž|#w0 Dž 3w{ ];ue.}_==|t |HPHE0k],~)8K/$ yFvFFFFۉ(Q+)()ˋ( FFFFFF}Nۉ$Q+)$)ˋ$ NQ+)Ӊ) ى vĉFģ FmFXFvvN~ F] FVFأډFVأFFFOvFFF#v _vFKv;vF'vvFvvFvvFvvF v v t=t=u \>'Q+)У+)ʉ)Ӊh + A c NQ)ˉQ.+ )УDž88))L8,BKML׃3w&}Lff9u .WD0\ @ =t,Wh05 t 4D9Dw=tHQhL5 5 H}u&=th_5 K2Dž8=tphq5 [=w8 Dž8 t184 Ph5 dh5 T8 u;8} =t&84 Ph5 t @@<< u~$~)@(PVh5 ]Džnڃ<~44 h5  C]ڃ͋4 h5  F$X@AH P@WBuL@A]H@G;FD@T9DdT@GT=kT[LSxS@T<@/@=@@GB($)@M)DDžn=t[4h5 ;Dt$Ph5  ;Duh5 STUVWXYZ[\]^@(@49^]D‰H w!ff9uH]H<uh<u=tT=t!84 Ph5  Dž<v49Du ,@DD H=t[4h*5 ;Dt$Ph5 q ;Duh5 VH4yLF Buڃ-}vu1?v=thA5 @@H[^_ÐU  < wƒУ.tu?ÐU1ÐUE `uh@ÐUut@1UWVSj=EPƅud}1эyDWEPRƒ u,<=u$StC…uvu1t/+uVEPRAƒ u<=t GuڅubPÃuLP5S@ED tRE1e[^_ÐUS1ۃ}u j ÃuHlt 9pt#jhtj ‰lpRj5,؋]ÐUS]SSz]ÐUS]u SuSW]ÉUSE] u SSPuS$]ÐUS=tЃ;u]ÍvUÐUS[Ç/]jdef`VrNRJsFuBu8u0versionuniversalutcuctsetrfc-822referencehelpfiledate-standard inputr`%s'invalid date ` %s'/usr/share/localesh-utilsd:f:r:Rs:uTZ=UTC0memory exhausted1.16GNU sh-utilsdate (%s) %s the options to specify dates for printing are mutually exclusivethe options to print and set the time may not be used togethertoo many non-option argumentsthe argument `%s' lacks a leading `+'; when using an option to specify date(s), any non-option argument must be a format string beginning with `+'undefined%sinvalid date `%s'cannot set datewrite error%a, %_d %b %Y %H:%M:%S GMT%a, %_d %b %Y %H:%M:%S %z%a %b %e %H:%M:%S %Z %Y %s Try `%s --help' for more information. Usage: %s [OPTION]... [+FORMAT] or: %s [OPTION] [MMDDhhmm[[CC]YY][.ss]] Display the current time in the given FORMAT, or set the system date. -d, --date=STRING display time described by STRING, not `now' -f, --file=DATEFILE like --date once for each line of DATEFILE -r, --reference=FILE display the last modification time of FILE -R, --rfc-822 output RFC-822 compliant date string -s, --set=STRING set time described by STRING -u, --utc, --universal print or set Coordinated Universal Time --help display this help and exit --version output version information and exit FORMAT controls the output. The only valid option for the second form specifies Coordinated Universal Time. Interpreted sequences are: %%%% a literal %% %%a locale's abbreviated weekday name (Sun..Sat) %%A locale's full weekday name, variable length (Sunday..Saturday) %%b locale's abbreviated month name (Jan..Dec) %%B locale's full month name, variable length (January..December) %%c locale's date and time (Sat Nov 04 12:02:33 EST 1989) %%d day of month (01..31) %%D date (mm/dd/yy) %%e day of month, blank padded ( 1..31) %%h same as %%b %%H hour (00..23) %%I hour (01..12) %%j day of year (001..366) %%k hour ( 0..23) %%l hour ( 1..12) %%m month (01..12) %%M minute (00..59) %%n a newline %%p locale's AM or PM %%r time, 12-hour (hh:mm:ss [AP]M) %%s seconds since 00:00:00, Jan 1, 1970 (a GNU extension) %%S second (00..61) %%t a horizontal tab %%T time, 24-hour (hh:mm:ss) %%U week number of year with Sunday as first day of week (00..53) %%V week number of year with Monday as first day of week (01..52) %%w day of week (0..6); 0 represents Sunday %%W week number of year with Monday as first day of week (00..53) %%x locale's date representation (mm/dd/yy) %%X locale's time representation (%%H:%%M:%%S) %%y last two digits of year (00..99) %%Y year (1970...) %%z RFC-822 style numeric timezone (-0500) (a nonstandard extension) %%Z time zone (e.g., EDT), or nothing if no time zone is determinable By default, date pads numeric fields with zeroes. GNU date recognizes the following modifiers between `%%' and a numeric directive. `-' (hyphen) do not pad the field `_' (underscore) pad the field with spaces Report bugs to sh-utils-bugs@gnu.ai.mit.edu &),#/0 %(+".$' *!-12 1 6 2<3:-. *+ ,!"#$%&/'0()31248597=;      8parser stack overflowparse error`lx\XdtĚ4H`t̛ܛܛ$$8HH\ll         {  v  n  e  \  UNFA70'" saturdayfridaythursthurthursdaywedneswednesdaytuestuesdaymondaysundaydecembernovemberoctoberseptseptemberaugustjulyjunemayaprilmarchfebruaryjanuarypj `[WRK G @ < secsecondminminutehourdayweekfortnightmonthyear  `    } t l hagotwelftheleventhtenthnintheighthseventhsixthfifthfourththirdfirstnextthislastnowtodayyesterdaytomorrow63/+'#< x,, hhXXXXL\\ |wso0j0e0`0idlenzdtnzstnztgsteadteastjstcctwadtwastzp6zp5zp4bteetfstfwtsstswtmeszmestmewtmetcestcewtcetidlwntahstcathdthstydtystpdtpstmdtmstcdtcstedtestadtastatwatbstwetutcutgmt<x,hXL\~ |zxlv0tzyxwvutsrqponmlkihgfedcbaama.m.pmp.m.dst }lfZTPKF>4digitpairsecondsyeardate'.'DIGIT$undefined.error$      Starting parse parser stack overflowStack size increased to %d Entering state %d Reading a token: Now at end of input. Next token is %d (%s) Shifting token %d (%s), Reducing via rule %d (line %d), %s -> %s state stack now %d parse errorDiscarding token %d (%s). Error: state stack nowShifting error token, d̮ @LdMemory exhaustedPʉډ *:JZjzʊڊ *:JZjz d ((  TPoԇoorGCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)01.0101.0101.0101.0101.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.bss.comment.note# 1((\7 ?Gorr`Toԇ0c l   Hu TT ~dd / 0ċ d)((5``5% TTTTTPPUV VPPPXYELF44 (444ccee /lib/ld-linux.so.2GNUCG<;' D-5 061"=F4 +7: A,EC8B3/92$@ () #&%*>!.? !e*d@4 FL4L_tXjf}T4W44$TMfD*fd/Ԑ! T@"ď2"t)f%2"-ԏ'"6=$2"ETdQ^crkč2"rԎ "~$)2"t"$#["DZ"JA"%dC D"$&f- 6Ď\>CL[t9ahdzg"ԍH"D"ffd__gmon_start__libproc.so.2.0.0_DYNAMIC_GLOBAL_OFFSET_TABLE__init_finireset_sort_optionsdev_to_ttylinux_version_codeopen_psdbwchanopenproccloseprocps_readproclook_up_our_selfuptimeHertzread_total_mainprocps_versiondisplay_versionlibc.so.6strcpyioctlgetgidprintfstdoutgeteuidsnprintfgetenvgetegidpersonality__strtol_internalbsearchgetpidgetpagesizeqsortmemcpygetuidmallocfprintfctime__deregister_frame_infostrncmpstrncpystrcasecmp__strdupsigfillsetsigactionlocaltimememsettimestrcmpgetpwnamsprintfstderrstrftime__xstatexitgetgrnam_IO_stdin_used_exitstrspn__libc_start_mainstrchrfputs__register_frame_infostrpbrkfree_etext_edata__bss_start_endGLIBC_2.0ii effff5fe e-e9e.e>e e@$e/(e2,e&0e4e 8etk<*t%<&t/ڐ<-t <E PW‹EU;t C„uEv1e[^_ÉUWVS}} bu ckjhtÃuh5fnW‹ujVRÃuh5f9ڃ;t :uG_e[^_ÐUWVSEx 1QgEEp EP1ۋ}v t~ ,t=t&t |  |u8=hutC1Guu;EPEPEP tG}rihWƅttj=W…tBvRWtʃ9t:uE@EH~sEPd1e[^_ÉUWVSEEx G%tt?EG%tu-EGuո`cvEPM1QEEp EPEx m%uEG?%tgP/GtrrÃEP1Ʉt:%tBA:uVWEP3 E%Ej És FV‰SEPs1CCCCڃ;t:uE@EXmEPLd1e[^_UVSE18-uF@P.Ãu1j =‹C BrЍe[^ÍvUWVSEx 1QEEp EPJ1] ,w$$u,tG1C;uׅu7EPvEPcEPO rtC]rMhSƅtStʃ9t :uE@EH^sEPd1e[^_ÉUWVSu tjZu18u_B8 2tVBu1G78t8t2zu1G78t8t:tRV1҉1I9uiʉs-tt+t3vPt)1<Zt"+t-u&=$dt < t  v B롐[^_ÐUWVS}1ۋw +tct -td1J>P+p"u "Yʃ9t :uGO1F됍e[^_UWVS}tPÃGHi$$WÃt!j%w ?tWÅ8d)=dt `W6Ãt$j%w t W~ÃdjuW_=du =dt vw XÃuWmd1=dttWƃt j%w Kt WƃuEdjbW11v=dtWd؍e[^_ÉUWVSuEjÉ1Qt‰S VRE CCCdd} u d} t }v,t t t "=t}uEu}uy}tfE1ۄt$,t t:=tBC t ,t uySVW ;W;)ƒWzMF„S1e[^_ÐUd,ddddÐUWVSu} V,dpu',d,d v8%v,dVpOtԋu1e[^_ÉUVSuV,dpu#,d,dRL#,dVptԋu1e[^ÍvUS0dt(du `(d=Xdt^t jhjhá,d,djhrá,d,d(duWjh7t jh vjh0á,d,djhá,d,djhá,d,d(dt#jhá,d,d(djhá,d,d(dUdtfjhná,d,dj C jCf:CCCC,d,djhá,d,d(dtG0dt jhvUdt jh jhá,d,d0dt'jhá,d,djh.v(dtDjh_á,d,djhDá,d,d0d(dt-t)jhá,d,d0d(dt)u$jhá,d,d0dt$jhá,d,d0dt$jhá,d,d0dt9jheá,d,djh Já,d,d(dtjh #á,d,djhtlmnopqrstuvwxyz{|}~á,d,d(dtUdt jh jh vtljh á,d,d(dtEjh á,d,d0dujh ná,d,d0d tjh! Gá,d,d0d1]ÍvUVSETdt t1hdtP=,dt h@ Cdt-KCtʋ ,d,duuՋdt.vKCtʋ ldlduuՃ=,dt=(du~W(dw$w tathMtgwU{v@wtxw ti&v to=t}w =tl =tqa v1etd]pdU|dMxdE} > 6c-c%ddd  1u&=0duh Rt 8tþt+jS#ƒt,ы,d ,du#0d]t vthjh Sh uSh u jhSh u  _0dt7h!  jhESh# t h# 0dh( h- h1 h4 h6 jhSh9 $u @ vh9 jjhShf u j }uwUdt4(dt+jhbPh# t h# Udt1(dt(jh %Phw bt hw 1e[^U1ÐUEU H`B`9} 91ÐUEU HdBd9} 91ÐUEU HhBh9} 91ÐUEU HlBl9} 91ÐUEU HpBp9} 91ÐUEU HtBt9} 91ÐUEU HxBx9} 91ÐUEU H|B|9} 91ÐUEU 9} 91ÐUEU 9} 91ÐUEU 9} 91ÐUEU 9} 91ÐUEU 9} 91ÐUEU 9} 91ÐUEU 9s 9w1ÐUEU 9s 9w1ÐUEU 9s 9w1ÐUEU 9s 9w1ÐUEU 9s 9w1ÐUEU 9s 9w1ÐUEU 9s 9w1ÐUEU 9s 9w1ÐUEU 9s 9w1ÐUEU 9s 9w1ÐUEU 9s 9w1ÐUEU 9s 9w1ÐUEU 9s 9w1ÐUEU 9s 9w1ÐUEU 9s 9w1ÐUEU 9s 9w1ÐUEU 9s 9w1ÐUEU 9s 9w1ÐUEU 9s 9w1ÐUEU 9s 9w1ÐUEU 9s 9w1ÐUEU 9s 9w1ÐUEU 9s 9w1ÐUEU 9s 9w1ÐUEU 9s 9w1ÐUE  PE PUE PEPUE ,PE,PfUE <PE<PJUE LPELP.UE \PE\PUE lPElPUE |PE|PUE PEPUEU 9} 91ÐUEU 9} 91ÐUEU 9} 91ÐUEU 9} 91ÐUEU 9} 91ÐUEU 9} 91ÐUEU 9} 91ÐUEU 9} 91ÐUEU 9} 91ÐUEU 9} 91ÐUEU 9} 91ÐUEU 9} 91ÐUEU 9} 91ÐUEU 9} 91ÐUEU 9s 9w1ÐUEU 8} 81ÐUj-h 5dGÐUWVSdu 1=$dutc= \_ | JtF v)УdEF +Ed}tVt ҉#vv5d芺1IV$<=t)E1v %^ )y1ۃ=duy1u=dt ^ )˅}a>tdF 6>t dF &M+MM+U)ʅd5fh<E+EU~d)Ph 5f謶UF EEE ~ttztEE EօM5fh<Ue[^_ÐUhj 5d藸 jj{j+J Ͷ= tj(==Z=tdOv=t! =@t$:=u1[NB 6h =5fp   ÐUSxt d@.B; D8t Z1]ÐUEjjPu‹E8td| E 1vdÐUS]EjjPS蠵ƒE8tS}u d+P|t ҋE 1d]ÉUS]EjjPS8ƒE8tS襳u d+P|t ҋE 1d]ÉUjuu H1UXWVSu>/u EPVjd(dGVh,>hSI}WSj* Vh8>hSWSj Vh@>hSWSjڳ VhK>hSδWSj貳 }wVhV>hS誴WSj莳 }SBӅuFt*BuFt~WVjSM A1,vE%= uEȋŰM Q1vd[^_UWVS]j蝲E1э Q‹uVF1Q\E SV譴1MEg>v t t t ,utG1AÄuȅExMrUʊ : tBt t,u:t1ۅtuvPQu ։Eu%KsEPX5ddE0dd1 uV;Ep0uV'Ee[^_USPhz>au dz$CCÅu >vh,S%dd@ Åu >vhSdd@ |$duU 0d ?]v 0d `?IvLdÅu ?!vjStv[Åu ?vh\S=dd@ =u!Pu BuBt @苯j4 hdl 0d` hdTcE (dd.Åu `@1vhSuudd@ hSQudd@ @=xdt (dv 0d (dAÅu AvHd}Åu `AivjS dQÅu A=vhS'dd@ cÅu AvhSEdd@ 'Åu Bvh@S dd@ Åu PBvh\Suwdd@ gvdD 0d;v@@KhnBBB9vhB.B%vBH x1]ÐUVS8-u=dRDbHTdt=d,E<=d@E#F@F lFG`AGj9j0Kd dQC Cddddvx_$`HjEpEd=uPuBt E7j0E HdjP****---------------------------------*You found a bug!COLUMNSLINESYour %dx%d screen size is bogus. Expect trouble. ̗"̗|Ė|<(unknownunix98unix95unixsysvsunos4solaris2sgiscoposixoldlinuxirixhpuxhpgnudigitaldefaultdebiancompaqbsdaixOL_jOL_lOL_sOL_uOL_vPS_PERSONALITYCMD_ENVI_WANT_A_BROKEN_PSEnvironment specified an unknown personality.FB_jFB_lFB_uFB_vRD_fRD_jRD_lPOSIX2onUNIX95POSIXLY_CORRECTF5FMTFL5FMTJFMTL5FMTLFMTSFMTUFMTVFMT_XPG(none)BSD j %s BSD l %s BSD s %s BSD u %s BSD v %s SysV -f %s SysV -fl %s SysV -j %s SysV -l %s Linux version %d.%d.%d Compiled with: libc %d, internal version %d.%d header_gap=%d lines_to_next_header=%d max_line_width=%d screen_cols=%d screen_rows=%d personality=0x%08x (from "%s") EUID=%d TTY=%d,%d Hertz=%ld **** simple selection **** **** selection by list **** -A all processes -C by command name -N negate selection -G by real group ID (supports names) -a all w/ tty except session leaders -U by real user ID (supports names) -d all except session leaders -g by session leader OR by group name -e all processes -p by process ID T all processes on this terminal -s processes in the sessions given a all w/ tty, including other users -t by tty g all, even group leaders! -u by effective user ID (supports names) r only running processes U processes for specified users x processes w/o controlling ttys t by tty * output format * long options * -o,o user-defined -f full --Group --User --pid --cols -j,j job control s signal --group --user --sid --rows -O,O preloaded -o v virtual memory --cumulative --format --deselect -l,l long u user-oriented --sort --tty --forest --version X registers --heading --no-heading **** misc options **** -V,V show version L list format codes f ASCII art forest -m,m show threads S children in sum -y change -l format -n,N set namelist file c true command name n numeric WCHAN,UID -w,w wide output e show environment -H process heirarchy Process selection options conflict.LțInternal error in ps! Please report this bug. Ĝ<x,hL, END_BSDEND_SYS5pidSeriously crashing. Goodbye cruel world. Improper format specifier list.Improper format listEmpty format list. , =Unknown user-defined format specifier.Improper AIX field descriptor.Unknown AIX field descriptor.AIX field descriptor processing bug.%Improper sort specifier list.Improper sort listEmpty sort list.Unknown sort specifier.CGJKMNPRSTUcfgjkmnoprstuvy+-Bad sorting code.PPID sort and forest output conflict.option -O can not follow other format options.Multiple sort options.option O is neither first format nor sort order.Bug: parse_O_option got weirdness!\\\, =Modifier -y without format -l makes no sense.cmdargsbsdtimestatucmdtimetnamestimewchansgi_rss:szrsssgi_paddrpriclassnioprinlwpcpsrlwpsidpgidppiduseruid_hackuidsflabelBug: must reset the list first! Conflicting format options.RD_ljRD_fjOL_XOL_mPS_FORMATCan't use output modifiers with user-defined outputPPIDPIDInternal error, no PID or PPID for -j option.PGIDLost my PGID!FADDR%CPUCPUCPCNIPRIInternal error, no PRI for -c option.CLSLost my CLS!UID%c \_ | [%s]%u- %02u:%02u:%02u%ld%2u%2u.%u%u%d-%02d:%02d:%02d%lu%d%s-%lx%03lx%08lx - xx%5lu%2lu.%02lu%3ld:%02dxx%5ld%24.24s%H:%M%b%d%Y%8.8s %6.6s00000000%s0<%s*,,ؿ,,T,,8,,8,,8,,,,8,y,,q,i,h e,a,8X,R,|J,E,C,A,0ؿ:,3, -,),8%, 8, 8,,, , 8̹, 8\+y,+y,,++8++8+E,+ 88++8+ 8 ++8++,++\++Ƚ++ȼ++d+{+8s+g+8 c+_+D|Y+Q+ L+G+A+;+X9+7+2+-+&+++7+<+7+<+y,++****dX**,**dX**,**Ƚ**ȼ**| **8**8**ddz*u*8n*g*8_*W*8Q*K*8 G*C* =*5*8-*5*8#**x** **8*)8)+,))8\))8))8l))8))8@))8))̶)))))z)Lls)l)Lle)^)8W)P)8M)J)E)J)>)8)8/)))8#)))8))8,) )8)((*dd((8((8((8((8((8(((,ؿ((X ((X((X((x(,T( 8y(u(8p(k(g(*@^(* dW( 8Q( 8L(G(8C(?(88(4(81(.(8%( 8l ((h( (l((8''(''(''(''8''$8''<''''8''8''8''H''H'',''(}'x'(q'j'd' 8`'\'HX'(X N'i,h D'<' 1'*| ('!'X '3, '*| 'i,h ' 8@&&8&&$&*h&&8&&$L&R,ܻ&&(&'&&8&&&&D&~&tx&r&(j&b&\&V&DO&H&t@&9&86&(81&,&8$&&8&&8&E, &&%&%*x%% %)̶%%̶%%8%%8%%%%x%%x%*x%*x%%8%,%y,%%%%y%s%8m%h%Xd%`%8Y% 8T%h%XK%h%8D%`%8>%8%80%+%8$% %8|%%8 % %8%$8L$$ܸ$$$( $$8$ 8~XSTATxstatwchanvszVSZvsizeSTACKvm_stackLCKvm_lockLIBvm_libEXEvm_exeDATAvm_dataUTIMEutimeusrpriusertimeuseruprocpUPRuprUSERunameUMASKumaskuid_hackUIDuiducommucmdUPROCPu_procptty8tty4ttyTTttTSIZtsiztsessionTSESStsessTRSStrsstrsTPGIDtpgidtnametmoutTMOUTtimeouttimeTIDtidTHCNTthcountTDEVtdevszSYSTEMsystimeSVUSERsvuserSVUIDsvuidSVGROUPsvgroupSVGIDsvgidSUSERsuserSUIDsuidSTIMEstimeSTATUSstatusstateSTATstatstart_timestart_stackS_CODEstart_codestartSTACKPstackpSLslsizesigmasksigignoresigcatchSIGNALsig_pendsig_ignoreCATCHEDsig_catchsig_blocksigSIDsidshareSGROUPsgroupSGIDsgidsgi_rssPsgi_psessionSESSsessSCscountSCNTscntSCHschedSsRUSERruserRUIDruidRTPRIOrtprioRSZrszrssizeRSSrssRLINKrlinkRGROUPrgroupRGIDrgidresidentRErePPRpsxpriPSRpsrPSETpsetprmidprmgrpprioritypriPPIDppidPOLpolicypoippmemPIDpidPGRPpgrpPGIDpgidPENDINGpendingpcpuPAGEINpageinPADDRpaddrP_RUp_ruoublockOUBLKoublkSZoszopriWCHANnwchanVCSWnvcswNSWAPnswapnsigsNSIGSnsignalsIVCSWnivcswniceNIniMSGSNDmsgsndMSGRCVmsgrcvMINFLTminfltMINFLmin_fltMAJFLTmajfltMAJFLmaj_fltTRSm_trsSWAPm_swapSIZEm_sizeSHRDm_shareRESm_residentLRSm_lrsDTm_dtm_drsLUSERluserLUIDluidSTARTEDlstartTTYlongtnamelognameLOGNAMEloginLIMlimLABELlabelKTRACEPktracepKTRACEktraceJOBCjobcPRIintpriinblockINBLKinblkIGNOREDignoredGROUPgroupGIDgidFUSERfuserFUIDfuidFSUSERfsuserFSUIDfsuidFSGROUPfsgroupFSGIDfsgidfnameflagsflagFGROUPfgroupFGIDfgidFfEUSEReuserEUIDeuidELAPSEDetimeESPespENVIRONMENTenvironE_CODEend_codeEIPeipEGROUPegroupEGIDegidDSIZdsizDRSdrsCWDcwdcutimeCURSIGcursigcstimecputimeCPUcpuCPcpcommandcommcnswapcmin_fltCMDcmdcmaj_fltclsCLSclassCAUGHTcaughtCcTIMEbsdtimeSTARTbsdstartBNDbndBLOCKEDblockedCOMMANDargsARGCargcALARMalarmADDRaddracflgACFLGacflag%MEM%mem%CPU%cpu ;::::::::l:f:@:0:::999v9@9988888p8@888777`7@7768666`6E66555`5C55444`4G44333@332222p2k2@2422111`1I11000`0A00///`/Y/ / /....`.$$pid,tt,state,time,sl,pagein,vsz,rss,pcpu,pmem,commandVFMTuname,pid,pcpu,pmem,vsz,rss,tt,state,start,time,commandUFMTuser,pcpu,pri,scnt,wchan,usertime,systimeTHREADf,s,uid,pid,ppid,c,opri,ni,addr,sz,wchan,tname,time,ucmdStd_lf,s,uid_hack,pid,ppid,c,opri,ni,addr,sz,wchan,stime,tname,time,cmdStd_fluid_hack,pid,ppid,c,stime,tname,time,cmdStd_fuid,pid,cursig,sig,sigmask,sigignore,sigcatch,stat,tname,commandSFMTuser,pcpu,pri,usrpri,nice,psxpri,psr,policy,psetSCHEDminflt,majflt,nswap,inblock,oublock,msgsnd,msgrcv,nsigs,nvcsw,nivcswRUSAGEflags,state,uid,pid,ppid,priority,nice,wchan,tname,bsdtime,pgid,sid,commRD_ljflags,state,uid,pid,ppid,priority,nice,wchan,tname,bsdtime,commRD_lpid,tname,state,bsdtime,pgid,sid,commRD_juid,pid,ppid,start_time,tname,bsdtime,pgid,sid,argsRD_fjuid,pid,ppid,start_time,tname,bsdtime,argsRD_fpid,tname,state,bsdtime,commRD_pid,tname,stat,bsdtime,maj_flt,m_trs,m_drs,rss,pmem,argsOL_vuser,pid,pcpu,pmem,vsz,rss,tname,stat,start_time,bsdtime,argsOL_uuid,pid,pending,sig_block,sig_ignore,caught,stat,tname,bsdtime,argsOL_spid,tname,majflt,minflt,m_trs,m_drs,m_size,m_swap,rss,m_share,vm_lib,m_dt,argsOL_mflags,uid,pid,ppid,priority,nice,vsz,rss,wchan,stat,tname,bsdtime,argsOL_lppid,pid,pgid,sid,tname,tpgid,stat,uid,bsdtime,argsOL_jpid,start_stack,esp,eip,timeout,alarm,stat,tname,bsdtime,argsOL_Xuid,pid,ppid,cp,pri,nice,vsz,rss,wchan,state,tname,cputime,commandLFMTf,state,uid,pid,ppid,c,pri,nice,addr,sz,wchan,tt,time,ucmdL5FMTuser,pid,ppid,pgid,sess,jobc,state,tname,cputime,commandJFMTflags,state,uid,pid,ppid,cpu,intpri,nice,addr,sz,wchan,tty,time,commHP_lflags,state,user,pid,ppid,cpu,intpri,nice,addr,sz,wchan,stime,tty,time,argsHP_fluser,pid,ppid,cpu,stime,tty,time,argsHP_fHP_f,state,uid,pid,ppid,pcpu,pri,nice,rss,wchan,start,time,commandFL5FMTflags,state,uid,pid,ppid,priority,nice,vsz,wchan,tty,time,pgid,sid,commFD_ljflags,state,uid,pid,ppid,priority,nice,vsz,wchan,tty,time,commFD_lpid,tty,time,pgid,sid,commFD_juser,pid,ppid,start_time,tty,time,pgid,sid,commFD_fjuser,pid,ppid,start_time,tty,time,commFD_fpid,tty,time,commFD_pid,stat,time,sl,re,pagein,vsz,rss,lim,tsiz,pcpu,pmem,commandFB_vuser,pid,pcpu,pmem,vsz,rss,tt,stat,start,time,commandFB_uuid,pid,ppid,cpu,pri,nice,vsz,rss,wchan,stat,tt,time,commandFB_luser,pid,ppid,pgid,sess,jobc,stat,tt,time,commandFB_jpid,tt,stat,time,commandFB_uname,pid,ppid,c,start,tname,time,cmdF5FMTstate,tname,time,commandEND_SYS5state,tname,cputime,commEND_BSDpid,tname,time,cmdDefSysVpid,tname,stat,bsdtime,argsDefBSDpid,tname,state,cputime,cmdDFMT0C(,G**Pp(k(UT%h%a,y,c+y,g( (nE)J)p((r((tY+Q+u''x&E,y%*z$$~$$C(G%J+M)N,Pp(R%(Sd'T&U%c,f+g(j+k>%m)n ,o'p(r's't%uT%v$y^(~$%-12.12s %-8.8s Fix bigness error. bad alignment code tUnknown page size! (assume 4096) Process ID out of range.Process ID list syntax error.User ID out of range.User name does not exist.Group ID out of range.Group name does not exist.TTY could not be found.List member was not a TTY./dev/pts/%s/dev/%s/dev/tty%s/dev/pty%s/dev/%snsole-?Improper list. , aAdefgGlnoptuUList of command names must follow -C.List of real groups must follow -G.Use -m to print threads, not Sun's nonstandard -L.Sorry, no Mandatory Access Control support.Format or sort specification must follow -O.List of real groups must follow -U.-VThe -V option is exclusive.Don't understand MAC on Linux.List of session leaders OR effective group names must follow -g.List of session leaders OR effective group IDs was invalid.Thread display not implemented.System.map or psdatabase must follow -n.Format specification must follow -o.List of process IDs must follow -p.List of session IDs must follow -s.List of terminals (pty, tty...) must follow -t.List of users must follow -p.ARRRGH!!! - Embedded '-' among SysV options makes no sense.ARRRGH!!! \0 Please report the "SysV \0 can't happen" bug.Unsupported SysV option.<PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP(PPPPPPPPPPPPPPPPPPPP|PPPPPP,<PPPPPdPPP PPPPPPP,PPP PP\P P Can't happen! Problem #1.Can't happen! Problem #2.2nd chance parse failed, not BSD or SysV.Option A is reserved.Option C is reserved.LThe L option is exclusive.Option M is unsupported, try N or -n instead.System.map or psdatabase must follow N.Format or sort specification must follow O.List of users must follow U.VThe V option is exclusive.Obsolete W option not supported. (You have a /dev/drum?)Only one heading option may be specified.Obsolete k option not supported.pmemList of process IDs must follow p.Embedded '-' among BSD options makes no sense.Please report the "BSD \0 can't happen" bug.Unsupported option (BSD syntax)$4| ,<HL\h^L4YLxTLLLAL 8L81L*L$L$LL LLKhKKKLKdKdKdKdKdKdKdKdKKKKLKK|K,wKloKiKdKzerowidthversionuserttysortsidrowspidnullnulnoheadingsnoheadingnoheadersnoheaderno-headingsno-headingno-headersno-headerlinesinfohtmlhelpheadingsheadingheadersheadergroupformatforestdeselectcumulativecolumnscolsUserGroup:=Unknown gnu long option.List of real groups must follow --Group.List of real users must follow --User.Number of columns must follow --cols, --width, or --columns.Option --cumulative does not take an argument.Option --deselect does not take an argument.Option --no-heading does not take an argument.Option --heading does not take an argument.Option --forest does not take an argument.Format specification must follow --format.List of effective groups must follow --group.--helpThe --help option is exclusive.--infoThe --info option is exclusive.Option --html does not take an argument.Sorry, --html is not implementedList of process IDs must follow --pid.Number of rows must follow --rows or --lines.Option --null does not take an argument.Sorry, --null is not implementedSome sid thing(s) must follow --sid.Long sort specification must follow --sort.List of ttys must follow --tty.List of effective users must follow --user.--versionThe --version option is exclusive.way badGarbage option. ? %s Something broke. |h(h8|hERROR: %s Signal %d caught by ps (%s). Please send bug reports to start_timeCould not find start_time! ppidCould not find ppid! This /bin/ps is not secure for setuid operation.This /bin/ps is not secure for setgid operation.@4@@44444@444444444@4444444@dᆳᆳᆳᆳᆳᆳᆳᆳᆳᆳᆳᆳᆳxhxV4xV4`=y======>ezʍڍ *:JZjzʎڎ *:JZjzʏڏ *:JZjzʐڐ 4 (ȇX  d|L0o,ooGCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)01.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.bss.comment.note# 1((07 XXp?ȇGo To,, c LL l TT (u ||  ~44 /dd duv] cddddefIJ ELFP4L4 (444|||||, /lib/ld-linux.so.2GNU      ("3):І+FP"K\`"cov"} $p["" "00"@""H"&"__gmon_start__libcrypt.so.1libc.so.6textdomainprintfgetopt_longputs_nl_msg_cat_cntrmalloc__dcgettextopterrcallocfprintf__deregister_frame_infooptindreallocgetcwdsetlocalestderrerror__errno_locationexitbindtextdomain_IO_stdin_used__libc_start_main__register_frame_infofreeGLIBC_2.0ii +   Ğ Ȟ̞ОԞ؞ܞ US[\tR2]5%%h%h%h%h%h %h(%Ğh0%Ȟh8p%̞h@`%ОhHP%ԞhP@%؞hX0%ܞh` %hh%hp%hx%h%h%h%h1^PTRh\hЅQVh$U=u8PС8upt hÉUÍvUthh1ÍvUÐUS]tU5Пt 9ԟt#jhj ‰ПԟR5 5؟t 9ܟt#jhnjji ‰؟ܟR.t 9t#jhj& ‰Rt 9t#jhj ‰R8SvUVSu] hjhh/hUhhɍh΍hۍSV,tGt 9t#jhߍj= ‰Rjjn ÅuLt 9t#jhj ‰R00j ShjUVSu}uNjh h]u jlt0htvt $jփuuuh_.jWve[^ÐUWVS~VE&WÃ;"u, VUREVUR ǃtȅtEvƋUR1e[^_ÐUS1ۃ}u jÃuHt 9t#jhkjW ‰Rj5؋]ÐUS]SSz]ÐUS]u SuSW]ÉUSE] u SSPuS$]ÐUS=tЃ;u]ÍvUÐUS[;]Try `%s --help' for more information. Usage: %s [OPTION] Print the full filename of the current working directory. --help display this help and exit --version output version information and exit Report bugs to sh-utils-bugs@gnu.ai.mit.edu/usr/share/localesh-utils1.16GNU sh-utilspwdignoring non-option argumentscannot get current directory%s XhPvversionhelp+%s (%s) %s Memory exhausted&6FVfvƆֆ&6F Ѕ \(|܁ + 0(oooGCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)01.0101.0101.0101.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.bss.comment.note# 1((7 ܁?||5Go4To c l  u 00 ~Ѕ/PPP \\   ||`doELF4|G4 (444(@(@(@((,A,, /lib/ld-linux.so.2GNU%7+!4&-035 / %" 62#(.1 *'), $ d"%t),3+?It7"P@W"\,gxċ:"T."477""4\$T$ԋ"7"Ԋ3" d7"Tj""Ԍ4"*t84)?D"F "Qd:[bls"y$CN""*D="gČl" t"D7"%$"__gmon_start__libc.so.6textdomainprintfstdoutgetopt_long__ctype_bfchdirmemcpyputs__overflow_nl_msg_cat_cntrmallocisatty__dcgettext_obstack_newchunkrmdirreaddirabort__lxstat_obstack_beginfprintf__deregister_frame_infochdiroptindstdinferrorunlinkrealloc_IO_getcopendir__assert_failstrcmpgetcwdeuidaccess__mempcpyfclosesetlocalestderrerrorobstack_freefflush_unlockedfwrite_unlocked__errno_locationexitbindtextdomainrpmatch_IO_stdin_used__libc_start_mainopenstrchrclosedir__register_frame_infoclosefreeGLIBC_2.1GLIBC_2.0ii *ii 4(& pt2x |.4 5*%+  -()0$31,"6 ! #' $US[EtNuo(]5h%l%ph%th%xh%|h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h%h%hp%h`%hP%h@%h0%h %h%h%h%h%h%h%h%h %h(%h0% h8p%h@`%hHP%hP@%hX0% h` %$hh1^PTRhhQVhďoU=0u8P,С,8uԋt hP0ÉUÍvUthhPÍvUÐUS]tU5t 9t#jhjn ‰R5 5t 9t#jhj ‰R~ t 9$t#jh j ‰ $R;(t 9,t#jhj ‰(,R8SzUS]CCCjC C]U,WVSu Eh)jh*h<h<a}Wft;RtTtpddt]rt? it(Nvt;EEEvEE2EE"EvE vjjhhFVMQ\=<t#hMhQh_rj#v=8t j\M9 u\}tj0t 94t#jhkj ‰04Rjj0j};E}l]4l 4SWjSƒBvh}hhhvuEH ;E|V}tcMQUWVS] 5=H1ɡ)9rhhhhB19wB9vuQjW0e[^_UE1u ÍvUUE 9%ÐUVSu ]1ɀ;t" Cʁt11ڐ1Ѝe[^ÐUu uZ%ÉUWVSE MU}9wM)ӋMv)ʉUM1RuVQM‹E؍e[^_UWVSL H)ȉEȉE}1щMNE\;8vvS5448uXuV]SMQEPhh@!VSMQEPRh@ }t[@_DE_MQEP54Q FVMQR` 419thahXhhЍe[^_ÉUEU `ÍvUS1ۍEPuj u:PPu ju%\9EuP9EuT9E؉؋LÍvU$WVSEE=@t%@h$hċjjh@<t?Rt(hιPhйO0j&E<@A5<ǃ .u  tܴڃ .tՃ}tG PEPƒu_ ]UUEEE tUG E1эyLD;Pv QVV WSRY F F F H9LuN(FV !‰V N)ʋ~)9~~ F FEPjEP ƒ ;UvUEHvhӹh)hh}}}udjh̒hj zEuGlt 9pt#jhLj ‰lpRjj\ WSEPn }ugtt 9xt#jhLj ‰txRjj ;^v;^s ^^ SVa=<<uahι<;uE8u#hιMPhй3jzE<t?Rt(hιPhйd0j;E<}t EP8F9F t H;Vv;Vs VV RVmEe[^_ÉUWVS]1;M 9,yu y jW? CuhhhhuC%=W/P5Cuhhhh5C%=@u=|t 9t`jhj ‰|;t 9t#jhjC ‰P5CM yWDP5CuhhhhJC%=@u=t 9t`jhj ‰;t 9t#jhjW ‰P5Wu M ytJWaPt 9t#jhj ‰RL W3tlg8uM 9uZWPt 9t#jh"j~ ‰R0jve[^_ÍvUWVSE1ExuKSuPt 9t#jh5j ‰RjE8uXxux tLjSt=t 9tijh`j ‰DExt<t 9t#jhjN ‰ׅt)SP5W5z=ExtJSOPt 9t#jhj ‰R: } tEPht vS}cSPt 9t#jhj[ ‰R0j} tEP1эy}@ULEE;Pv RV,WSv o ~ L@;Pv jVF /F E;vjhjEP5 1эA$)ĉeQSEP ËEP9E )h0hhh8Twh0hhhFr L+H9sh0hhh`EߡP)9} WV~ +wh0hhh)Ѓ}jh} t,jj}W{ t WWah$>}OSePt 9t#jh@j ‰R0Ex}t=t 9t+jhj ‰RSP5t 9t#jhlj= ‰R5|?u 1ExtJSIPt 9t#jhj ‰R4 S[K8u E8u[ShιtISPt 9t#jhjE ‰RjFvSvPt 9t#jhj ‰RWjn8Ee[^_ÐUhWVS}} tr7'8.ucPt .uWxuQt 9t#jh"jt ‰Rjj/vGuGt OMEP7jc uOUWEG U{vM9t8u 75P t 9t#jh<j ‰ RP0j'qE%=@EP)w j;0XP5 à }uGt 9t#jhLj ‰Rjj At 9 t#jh`j ‰ Rjj9  )P5P;Prj Pp v @s5TP;Prj P< v @5SSMMyt]$t 9(t#jh!j ‰$(Rjj] t vje}@u MytMQW9kvE tj/7d%MQPWËG EEP5 uh,hrhh/PN؍e[^_Uh$hċjjh@)h$hċjjh(h$hph\j5(ÐU5b@1jP1jPUUЀ:tv8/uP@8uÐUS]56tFt 9t#jhFj* ‰RjS 5tHt 9t#jhFj ‰Rg0S?]ÉUj6UE@ÐUE@ ÐUE@ÐUVSE1ۋ@9s.ƍv9tAt vB@u9vӃ9r׉؍e[^ÉUWVS}11ɋG9s!ƃ:tCABt A@u9r;_ u ;Ou1e[^_ÉUWVS]SBS"S&ES5Wh`M QVhwM QE1RP,$ؾɉ1RP,$($MQhM QShM Qe[^_UWVSu} vWFЉ‹Ѓ;Frhhhh{v8u# Åt3WFЃu[u1e[^_USUzu1#vR9svu 9r؋]ÍvUWVS]} sWCЉ‹ ЃC9rhhhh0ʅt9:uruRu9s‹u 9r1e[^_ÐUWVS1ۋ}7;ws5>t#t} v;]sCIu};wr͉؍e[^_ÍvUWVS1U2;rs3>t!tUR3U ҃tG[uU;rrωe[^_ÐUWVS]u 1ɀ;t)1C;uȍe[^_ÉUWVSM 9s1t G4G9r1ЉЍe[^_ÐUS] whhhh)CvvSt؋]ÐUWVS}} ttj$VÃu 1E s PyCP% u StʼnsS9s@9rC Cu s{ECC ؍e[^_ÉUWVS}7G9sfVU>tOUt&Gt3ЃG C_ [u܋Gt6ЃUGE9rG Ge[^_ÍvUWVSUzt8zt2:;zs+?tt3UBЃ[uU;zrՋU:;zs(v_tsSuU;zrۋUZ tsSuU2URe[^_ÍvUMA t ‹BA jM‰ÍvUEU H JP ÉUWVS}u wVGЉ‹Ѓ;_rh9hthhEtkPVGЃtV3}tFKMt QSQ)'0VGЃtS2}t BCRW= [Cu1e[^_UWVSMyt$} tuvvvM Qǃu 1vuF G M;Nu> Mu VQGЉ‹ЉU;WrhIhhh`nKM;]t SWfu>t#W-ƒZM FBV MuG ]nEMu;NCu6GFGFG F We[^_UWVS]u }uhhhhjEPVSt}CE8t1SW…u \2E@BEPBv0C HK Ds9w vu@PPS1e[^_ÍvUS]jEPu S …u1E8uK KЋ]ÐUS]C=Dt(jh} hv=Du'Cuh0jl1]ÐUWVSu}1ۋ|LP2tiuԿPtտԿPE uܿPh'0j%v}vh 0j؍e[^_US]| PuCtPE]UWS]1эQ~ 9/u IJe[_ÐUWVSzVE&SÃ;"u, VUREVURǃtȅtEvƋUR1e[^_ÐULthj5HÉUSuÃu؋]ÍvUSu uMÃu؋]UVS1ۍu# t1C}vuDP u3C58ƒu3V%x[^ÐUST=TtЃ;u]ÍvUÐUS[ã ]dfirv8<versionhelpverboserecursiveinteractiveforcedirectoryTry `%s --help' for more information. Usage: %s [OPTION]... FILE... Remove (unlink) the FILE(s). -d, --directory unlink directory, even if non-empty (super-user only) -f, --force ignore nonexistent files, never prompt -i, --interactive prompt before any removal -r, -R, --recursive remove the contents of directories recursively -v, --verbose explain what is being done --help display this help and exit --version output version information and exit Report bugs to ./usr/share/localefileutilsdfirvR4.0GNU fileutilsrm (%s) %s too few argumentsmainrm.c((status) == RM_OK || (status) == RM_USER_DECLINED || (status) == RM_ERROR)print_nth_dirremove.cdepth < current_depth ()pop_dirn_lengths > 0top_len >= 2__extension__ ({ struct obstack *__o = (&dir_stack); (unsigned) (__o->next_free - __o->object_base); }) >= top_len__extension__ ({ struct obstack *__o = (&len_stack); (unsigned) (__o->next_free - __o->object_base); }) >= sizeof (size_t)[...]full_filenamestrlen (buf) + 1 == n_bytes_neededfspec_filetype_modefs->have_filetype_mode.%sremove_cwd_entries((status) == RM_OK || (status) == RM_USER_DECLINED || (status) == RM_ERROR)virtual memory exhausted%s: remove write-protected directory `%s'? %s: remove write-protected file `%s'? %s: remove directory `%s'? %s: remove `%s'? removing %s cannot unlink `%s'%s: is a directory%s: directory `%s' is write protected; descend into it anyway? %s: descend into directory `%s'? removing all entries of directory %s cannot change to directory %s..cannot change back to directory %s via `..'%s: remove directory `%s'%s? (might be nonempty)removing the directory itself: %s cannot remove current directory `%s'cannot remove directory `%s'cannot remove `.' or `..'cannot remove `%s'WARNING: Circular directory structure. This almost certainly means that you have a corrupted file system. NOTIFY YOUR SYSTEM MANAGER. The following two directories have the same inode number: continue? rmold_ent != ((void *)0)write error# entries: %u # buckets: %u # buckets used: %u (%.2f%%) max bucket length: %u Y@hash_lookuphash.cbucket < table->bucket_limithash_get_nextnext_primecandidate >= 10hash_find_entryhash_rehashnew_bucket < new_table->bucket_limithash_insertentry.cannot open current directorycannot get current directory from saved working directorycannot return to %s%s%s%sMemory exhausted`,ڊ *:JZjzʋڋ *:JZjzʌڌ *:JZjz  ( * dp$8oooNGCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)01.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.bss.comment.note# 1((x7 p?>GoNNnTo0c l 0u $$ p ~ /Ċ  &33H ((@(PP@TT@\\@dd@,,AA AsE,FELF4t24 (444p-p-p-ppLx/ /lib/ld-linux.so.2GNU%, #')  + %*(& "$! !*@ FL+ a)h0'"qp@}^r2"Љ"Pr)"m" `$>"["Ŀ @"PZ"0" )`2$:A\I"Zp_\h$w@@"g H"@:"__gmon_start__libproc.so.2.0.0_DYNAMIC_GLOBAL_OFFSET_TABLE__init_finidev_to_ttylibc.so.6printfsnprintfsetpriority__strtol_internalbsearchgetpidfgetsperror__libc_current_sigrtminmallocstrncasecmpstrrchrfprintfkill__deregister_frame_infostdinreadstrcasecmpstrcmpgetpwuidgetpwnamsprintfstderr__xstat__errno_locationexit__fxstat_IO_stdin_used__libc_start_mainopenstrchr__register_frame_infoclose_etext_edata__bss_start_endGLIBC_2.1GLIBC_2.0Wii ii Ŀ% &' ľȾ̾ о!Ծ ؾ#ܾ$   US[5t]5%%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%ľh` %Ⱦhh%̾hp%оhx%Ծh%ؾh%ܾh%h%h%h%h%hp%h`%hP%h@%h0%h %h% h1^PTRhhQVhğU=xu8PtСt8u鸰t htrxÉUÍvU thȿhtÍvUÐUS]|9t$st#V)Shhf0]ÐU WVS}=URWU R}tU Rh(h y  PuV]Sh+h`Mh`h@55ĿjEPT$uh jE UuEhDjjhRLƒu/Ejj PusƒE8u~Džt5|tt|NE M v=u{pᆵuo+t -{tY|jj PSƒ|8u80|(pNE E ruv;-Q{GC;Cp1fcto3vint|u~Lvw=uh h`5|h5ijr;tNE M Wh 52 =u h vh`5 h5j0&t NE E DžlptWcttEu=u h h`5\h5IjRM\EXu:=uh h`5h5jShCj \QXP\Qjƒ E%= Džl=u7P‰uhK5^jgv EȉNE M {{-t?tXPSjWƒ |pDžl=u7 Q ‰uhK5jt NE E Shhtl=u8 Q}‰uhK5j'vh@ TNE E :2/9xjjPS7dx8uwl=u8 Q‰uhK5Vj_vd NE E tzuvlumtql=u8 Q-‰uhK5jvtNE E =uk=ub=uY=uPh`5f=u h vh`5@h5-j6=T T5 T  T` TTtOh5=u h h`5h5jt\ `tPh5j=u h vh`5Dh51j:tT tPh 5=u h vh`5h5j`t|Nh`5=uh h`5h5uj~pᆵtPh5R=u h vh`5,h5j"pᆳu Džpt} Džt`tDžt=ut  pD[^_ÉUWVS] ;u5uh 5cjlj/3EtEu3uu>suUj5j. EFu ELu-!ERu tt_iucSuV=t%KtU47s=vSC~ SuVuVhW5(1e[^_ÉUUE 02US]SuSh(h  ]ÐUU%PRh+h``ÐUSx=xtЃ;u]ÍvUÐUS[Ó]XFSZXCPUWINCHVTALRMUSR2USR1URGUNUSEDTTOUTTINTSTPTRAPTERMSTOPSTKFLTSEGVQUITPWRPROFPOLLPIPEKILLINTILLHUPFPECONTCHLDBUSALRMABRTSIGRTMIN+%d0%2d %s %c%s%d%d,%d%-8.8s %-8.8s %5d %-16.16s ? %-8.8s %-8.8s %5d %-16.16s %-8.8s %-8.8s %5d %-16.16s %d /proc/%d/statWARNING: process %d could not be found.Usage: kill pid ... Send SIGTERM to every process listed. kill signal pid ... Send a signal to every process listed. kill -s signal pid ... Send a signal to every process listed. kill -l List all signal names. kill -L List all signal names in a nice table. kill -l signal Convert a signal number into a name. %s ERROR: unknown signal name "%s". ERROR: garbage process ID "%s". Usage: skill [signal to send] [options] process selection criteria Example: skill -KILL -v pts/* The default signal is TERM. Use -l or -L to list available signals. Particularly useful signals include HUP, INT, KILL, STOP, CONT, and 0. Alternate signals may be specified in three ways: -SIGKILL -KILL -9 Usage: snice [new priority] [options] process selection criteria Example: snice netscape crack +7 The default priority is +4. (snice +4 ...) Priority numbers range from +20 (slowest) to -20 (fastest). Negative priority numbers are restricted to administrative users. General options: -f fast mode This is not currently useful. -i interactive use You will be asked to approve each action. -v verbose output Display information about selected processes. -w warnings enabled This is not currently useful. -n no action This only displays the process ID. Selection criteria can be: terminal, user, pid, command. The options below may be used to ensure correct interpretation. -t The next argument is a terminal (tty or pty). -u The next argument is a username. -p The next argument is a process ID number. -c The next argument is a command name. -L-lERROR: -%c used with bad data. ERROR: -%c with nothing after it. /dev/%sNo memory. ERROR: no process selection criteria. ERROR: general flags may not be repeated. ERROR: -i makes no sense with -v, -f, and -n. ERROR: -v makes no sense with -i and -f. ERROR: -n makes no sense with a signal. ERROR: -n makes no sense with a priority value. WARNING: %d signals -- adjust and recompile. ERROR: could not determine own name. sniceskillkillERROR: no "%s" support.    ֢Ѣ͢Ȣâ{vqlea\WPJE@&6FVfvƉ։&6FVfvƊ֊W  (4t  opooGCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)01.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.bss.comment.note# 1((L7 tt?44GoXTopp0c l u  ~/ !  "P pp-tt.xx...//( /\\1x1ELF4Xu4 (444fffЊj /lib/ld-linux.so.2GNUCZVQ-C>I/K:?9;<)P,D51' 4.S(&MJT B+E#2X$ %=W3NHAF@!ORG8" L*U 067Y  .x!5h:<)CdJ(S8?_'"h(ql{H@^Ȑ2"Ȓ"(r8"ȓ2"H"."(ؐJ"3"3"x" x2>'(".`!68$>>"CX[[ؒ:"aQlprX:"x`"h"x["xX|{8ȔHZ""Jx$("%CH|"D"h$$:)"0J8ؑAXJS$[ؓbȑlhssz"h%ؔyDhgHL""8`"CH "``!__gmon_start__libcrypt.so.1cryptlibc.so.6strcpychrootprintfstdoutgetloginsigemptysetsnprintfgetgrgid__ctype_bgetenvsetpriority__strtol_internalgetpidfgetsperrorputsexeclegetuidmallocisattyendpwentsiglongjmpsleepgetutentsetgroupsfflush__sigsetjmpstrrchrsetrlimitulimitenvironfprintfkill__deregister_frame_infochdirinitgroupsstdinumasksetgidsignalendutentgetspnamopenlogcloselogstrncmpstrncpystrcasecmprealloc__strdupstrtoksscanfexecvsigactionlocaltimememsettcgetattrtimegetgroupssyslognicestrcmpttynamegetpwuidgetpwnamendspentsprintffclosesetlocalestderrrewind__errno_locationexitsetbufgetgrnamfopenfileno_IO_stdin_used__libc_start_mainstrchrsetutentfputssetuidtcsetattr__register_frame_infofree__environ_environGLIBC_2.0GLIBC_2.1 ii #$ii -ii #dhG`Xl p'h,lLp@t7xQ|V8N?" (* U<FA&IH) $=6K;%S > /R -$P(+,204.8<@EDHCL3P TX\1`BdJh5lWpt9x|0M4#DT:US[iPt?]5`%d%hh%lh%ph%th%xh %|h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h%h%hp%h`%hP%h@%h0%h %h%h%h%h%h%h%h%h %h(%h0%h8p%h@`% hHP%hP@%hX0%h` %hh% hp%$hx%(h%,h%0h%4h%8h%<h%@h%Dhp%Hh`%LhP%Ph@%Th0%Xh %\h%`h%dh%hh%lh%ph%th%xh %|h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h1^PTRhh8QVhpU=u8PС8uXt hHrÉUÍvUththHÍvUÐUvUS]thjjc hjt DS]ÍvUjt@ u1 uPo%ÐUVSujV5h jjÃt!S/Åthjva=auPA=AuPVh=At P)tSjzS4 LhjvU0WVS}E5`Ehj'E 0‰j jhEEjƒt:t[ 5 E:t),u}?F}4G}F€:u؋} v>:>E>Ev}}8E><~2~}lDPE uStf8rFlAoMtHaSt|vuTt<hTtJeWt0kWtXn u i ] Q E  9 @- >! 1EE;t }?}uE=f1ɋE0Et1=l}]EDPt LJCEEu߀}-` QM}+UM)U};}fL8uuFE1ɋ}t'lE}DWtLBCE;uE0,t<` 0QM}+UM)U};}fL8uuF}E}AE@fDfDe[^_UWVSt|tv1ۃ8toUR4t C<u<tJ1ۋw>t@4U Rt"O΋UuBtC<uˋG<uDžoe[^_UWVSuu 8Ã{EPPE@URta=tJ;1IQ36ƒ u>tvB:u ;u>uu>tp(=(tZ;1IQ36Kƒ u.j/6t>tvB:u ;u>ue[^_UvUWVS] jQǸE.э4)u EPËK~9| |vKυu!URUEuBE}tJ~&SU|CE|9| (vt[t' 9}1e[^_ÐUvUSE ] jj PSƒu;] tUUEPPu\u1]ÉUjj URutPjju1ÐUWVS}E ] jj PSZƃuQ;] jjÃtS ÅthujWhwj[ v+1'vڃ8ux,tj ,PW uC9w Ku"9v^jjeÃt SÅthujAWVhjtSjS1e[^_ÉUWVS} 1ۋuF4$hVj # à jjVj5hVj*hVjjVjhVj hVj à VW1 à V ÃG؍e[^_ÐUWVS1󫍍󫍍󫍍󫍵hhu"1 vVQ'v|<#tr< tn1SQhQuAMQQmtu AuVQQhQ aQu#QQAMQQz[^_ÍvUS]h{t.3t h5hjYj[;,uCjhSq u&Cjj jP;B(wnRcjh S7 uCjj jPP3jhS u CjjjP%Pj,SXÅG]ÐUvUWVS}1?t%M Q3}uPF;uߍP&1?t߉F:uM Q3D؍e[^_ÉUWVS11U:tӐU R3tFG;u9uEUvPE1U:t)ӉǍvU R3tF;uދUЍe[^_ÉUWVS}1ۃ?tvC8uPE1ۃtuP7CuUЍe[^_UVS]u vVPu vu1e[^ÉUWVSu1ۃCj,PSt@퐍Pgǃ>u 5w vj,P t @ve[^_UvUVSJƅt;tSbt9ptVe[^ÐUvUVS@!E@!URD!L!P!'jRƸE.M)H!T!\!X!`!؍e[^ÐUvUVSuv XuXhVjjÃt!SÅthjv6v h jOcv 6urhEjjÃtSÅthj\6h`j tSj;S 1e[^ÍvUVSuvxtuhWjjÃtSÅthj6vhjStSjS^ vv1e[^ÍvUS]S[|@} t+htPt hS|1]ÐUvUWVS] u1҉RVSh7W&WEPWe[^_ÉU WVSh=uvj SƒڀtnlvDC tB:u tI#tDv=tB t DC t=uBRVVhWà 9PV[^_ÐUVSuvh?FthLvhN5h jjZÃt!SÅthdj6v6vhjtSjS jvh^F8vhFt8u F::Phi~uPjuP<6h06h$h$ tPvh.5 h6t6PhDtPv6hNh? h^tP5e[^ÐUvUWVSE }ujdu%UR/PhhS؃5jPURyNj7URhhS7 SjUWVSffhh<uoJ8jjǃtW9Džthjhhjo WjWvl6vD1эQ< tIjjlǃtWDžthjH5Dhh@v~#J1 t t uʅ勅1Ҋ B  t t싅  a#XPVPǃt5Vjt VjÃtVjtHjjcǃtWDžthj?5DhhvWE PƒPEPƒ޿jjǃtWDžthjhE PEPh=At RtWjjW$ h5hPUv޿&jjǃtWIDžthjhE PEPh@=At RatWjWl h5h PMv޿jj`ǃtWDžthj<hE PEPh=At RtWjW h5hQPvjjǃtWDžthj5Dhh@j!tWjrW, PhPQƒ PH1[^_ÍvUWVSfcfEeE1ۍMMQu 6vuBu BuBuZtJjjÃt SÅthj5DhhcvֿuYtHjj[ÃtSÅthj75DhhvGֿuetMtPjjÃtSÅthj5Dhhv$pMQRjj_ÃtSÅthj;5Dhh@jttSjSdMQRNu,ORMQNtkRMQ6u%MQjƒt 31e[^_Uu Qt@ u1 vuPÐUvUVSuF8/txPh=jjAÃt SrÅthj6vhjtSjS jvPvktxvh@jjÃtSÅthj6vhjtSjdS 6jve[^ÐUvUWVShÃtzj?hSVtW]SShahAu} t+-Rppp @@Ph W%0W\We[^_ÐUvUWShuÃtSh h!i u.hƒt:/uRh!!1D tS"!e[_ÐUvUujOÐUvUS]SWtSh65h+j T]ÍvUW}W1QR7‹}UvUWVSU1Iv}TRPvWۃPǃtWSƃ9~υ}h5h@DžhPSfSh5h `v19}Pv9tC9|9|9s^PWƒt=@މhjGÃ^u1WWV[^_ÐUSL=LtЃ;u]ÍvUÐUS[7){] $Package: shadow $ $Version: 19990607 $ $Id: su.c,v 1.13 1999/06/07 16:40:45 marekm Exp $SYSLOG_SU_ENABC???- %s %s-%s Sorry.su/dev/%s: must be run from a terminal -ENV_TZENV_HZTERMrootUnknown UID: %d Unknown id: %s xSU_WHEEL_ONLYYou are not authorized to su %s (Enter your own password.)/bin/shAuthentication failed for %s Expired account %s SUSU by %s to restricted account %s ENV_SUPATHENV_PATHPATH=/bin:/usr/binIFSIFS= + %s %s-%s HOMENo shell Cannot execute %s SU_NAME$Id: getdef.c,v 1.12 1999/03/07 19:14:36 marekm Exp $USERDEL_CMDUMASKULIMITUID_MINUID_MAXTTYTYPE_FILETTYPERMTTYGROUPSYSLOG_SU_ENABSYSLOG_SG_ENABSU_WHEEL_ONLYSU_NAMESULOG_FILEQUOTAS_ENABQMAIL_DIRPORTTIME_CHECKS_ENABPASS_WARN_AGEPASS_MIN_LENPASS_MIN_DAYSPASS_MAX_LENPASS_MAX_DAYSPASS_CHANGE_TRIESPASS_ALWAYS_WARNOBSCURE_CHECKS_ENABNO_PASSWORD_CONSOLENOLOGIN_STRNOLOGINS_FILEMOTD_FILEMD5_CRYPT_ENABMAIL_FILEMAIL_DIRMAIL_CHECK_ENABLOG_UNKFAIL_ENABLOG_OK_LOGINSLOGIN_TIMEOUTLOGIN_STRINGLOGIN_RETRIESLASTLOG_ENABKILLCHARISSUE_FILEHUSHLOGIN_FILEGID_MINGID_MAXFTMP_FILEFAKE_SHELLFAIL_DELAYFAILLOG_ENABERASECHARENV_TZENV_SUPATHENV_PATHENV_HZENVIRON_FILEDIALUPS_CHECK_ENABDEFAULT_HOMECREATE_HOMECRACKLIB_DICTPATHCONSOLE_GROUPSCONSOLECHFN_RESTRICTCHFN_AUTHyesCould not allocate space for config info. Ccould not allocate space for config infoconfiguration error - unknown item '%s' (notify administrator) unknown configuration item `%s'rcannot open login definitions %s [%m] " "$Id: port.c,v 1.3 1997/12/07 23:26:54 marekm Exp $r/etc/porttime*$Id: pwauth.c,v 1.9 1998/12/28 20:34:38 marekm Exp $Password: LOGIN_STRING$Id: encrypt.c,v 1.6 1999/03/07 19:14:35 marekm Exp $crypt$Id: getpass.c,v 1.9 1999/06/07 16:40:44 marekm Exp $r/dev/tty$Id: basename.c,v 1.2 1997/12/07 23:27:00 marekm Exp $$Id: console.c,v 1.5 1998/12/28 20:34:44 marekm Exp $:rCONSOLE$Id: env.c,v 1.9 1999/03/07 19:14:38 marekm Exp $SHLIB_PATH=SHELL=PATH=NLSPATH=MAIL=LIBPATH=LD_KRB_CONF=IFS=HOME=ENV=BASH_ENV=_RLD_=LC_LANGUAGE=LANG=%s=%sEnvironment overflow L%dYou may not change $%s $Id: isexpired.c,v 1.7 1997/12/07 23:27:05 marekm Exp $x$Id: limits.c,v 1.9 1999/03/07 19:14:39 marekm Exp $CNo logins allowed for `%s' Too many logins (max %d) for %s , l8D|LX$, l8D|LX$r/etc/limits%s%[ACDFMNRSTULPacdfmnrstulp0-9 -]*QUOTAS_ENABToo many logins. pri=ulimit=umask=$Id: list.c,v 1.3 1997/12/07 23:27:05 marekm Exp $$Id: myname.c,v 1.2 1997/12/07 23:27:07 marekm Exp $$Id: pwd2spwd.c,v 1.3 1997/12/07 23:27:07 marekm Exp $$Id: setugid.c,v 1.6 1998/07/23 22:13:16 marekm Exp $setgidCbad group ID `%d' for user `%s': %m initgroupsinitgroups failed for user `%s': %m setuidbad user ID `%d' for user `%s': %m CONSOLE_GROUPSWarning: add_groups$Id: setupenv.c,v 1.9 1999/03/07 19:14:41 marekm Exp $%s/%srDEFAULT_HOME/Unable to cd to "%s" Cunable to cd to `%s' for user `%s' No directory, logging in with HOME=/HOMESHELLENV_SUPATHENV_PATHPATH=/bin:/usr/binUSERLOGNAMEQMAIL_DIRMAILDIRMAIL_DIRMAILMAIL_FILE/var/spool/mailENVIRON_FILE$Id: shell.c,v 1.7 1998/12/28 20:34:53 marekm Exp $-%sCannot execute %s:r/etc/suauthCcould not open/read config file '%s': %m %s, line %d: line too long or missing newline%s, line %d. Bad number of fields. DENYDENIED su from `%s' to `%s' (%s) Access to su to that account DENIED. NOPASSNO password asked for su from `%s' to `%s' (%s) Password authentication bypassed. OWNPASSsu from `%s' to `%s': asking for user's own password (%s) Please enter your OWN password as authentication. %s, line %d: unrecognised action! , ALL%s, line %d: ALL in bad place EXCEPT%s, line %d: EXCEPT in bas place GROUP%s, line %d: GROUP in bad place %s, line %d: expect another token after ALL @`$Id: sub.c,v 1.6 1999/03/07 19:14:43 marekm Exp $Invalid root directory "%s" Cinvalid root `%s' for user `%s' Can't change root directory to "%s" no subsystem root `%s' for user `%s' $Id: sulog.c,v 1.4 1998/04/02 21:51:51 marekm Exp $SULOG_FILEa+SU %.02d/%.02d %.02d:%.02d %c %.6s %s-%s $Id: tz.c,v 1.4 1998/01/29 23:22:36 marekm Exp $rENV_TZTZ=CST6CDT$Id: ulimit.c,v 1.2 1997/12/07 23:27:11 marekm Exp $$Id: xmalloc.c,v 1.3 1998/12/28 20:34:56 marekm Exp $malloc(%d) failed $Id: addgrps.c,v 1.4 1998/12/28 20:34:41 marekm Exp $,:Warning: unknown group %s Warning: too many groups XzmZMF=2+! }l\SI:0"rh\QI;, /etc/login.defsztke^R//bin/sh~ΐސ.>N^n~Αޑ.>N^n~Βޒ.>N^n~Γޓ.>N^n~Δޔ.>N^n~$ 8 (D # \0o0oo|GCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)01.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.bss.comment.note# 1((|7 ?DD 7Go|| To00 Pc  l  (u   ~88/hh :P@@P fxHHiLLiTTi\\iTj``k@ `k7rD{t#!/bin/sh usage="Usage: $0 [OPTION]... Exit successfully. --help display this help and exit --version output version information and exit Report bugs to sh-utils-bugs@gnu.ai.mit.edu" case $# in 1 ) case "z${1}" in z--help ) echo "$usage"; exit 0 ;; z--version ) echo "true (GNU sh-utils) 1.16"; exit 0 ;; * ) ;; esac ;; * ) ;; esac exit 0 ELF4Hi4 (444lalalallc /lib/ld-linux.so.2GNUCX!+P B@8()R$=1D3KNA2U 7?JW T>S0<"-VH#*G9QMO:CL; '6%4F /&.E5I, !!",`8ȓ@">)E`L8)U2"]X+ipsȒ>"h^2"8"()r(@"2"3"l"txx1 h,  5h:;x.MX\VH>]$eؒl4v8>"~["xX3"H8(:"2Z"HJ8Ah" g"XL"#ؐ"*X3ؓ":H($P8WHadh:"oP7 u^ؑ\h"ȑ>"("HVyȐh@"xg@"H":"`0 #E,00 6";x"__gmon_start__libc.so.6strcpytextdomainsys_siglistioctlprintfstdoutstrerrorgeteuidgetopt_long__ctype_bauthunix_create_defaultfchmod__strtol_internalgetpidfgetsmemcpyperrorreadlinkgetuidgetpassfeof_nl_msg_cat_cntrmallocoptarg__dcgettextclnt_perrorxdr_void__ctype_toupperrealpathalarmclnt_pcreateerror__lxstatrenamefprintfstrcatinet_addrumount2__deregister_frame_infofseekoptindferrorstrstrclntudp_createstrncmpstrncpyunlinksyncstrcasecmp__strdupstrtoksigfillsetsigactionindexxdr_stringmountstrcmpgetpwuidgetcwdgethostbynamesprintffclosesetlocalestderrumounterrorsigismember__xstat__errno_locationlinkexitbindtextdomainsigdelsetfopenfileno_IO_stdin_used__libc_start_mainopenstrchrfcntl__register_frame_infoclosegetfsspecvfprintfgetfsfilefreesigprocmaskGLIBC_2.1GLIBC_2.0ii Gii Q``d@hlp tx)4"*5OCQK9R#/?:E 6'FDT  A(H +$!(,W0-4,8%<M@ D$HLPTPX\>`2d hNlp<t1xG|V;8.J3=&I7 0US[Ûb0to'ZB]5%%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h%h%hp%h`%hP%h@%h0%h % h%h%h%h%h% h%$h%(h %,h(%0h0%4h8p%8h@`%<hHP%@hP@%DhX0%Hh` %Lhh%Php%Thx%Xh%\h%`h%dh%hh%lh%ph%thp%xh`%|hP%h@%h0%h %h%h%h%h%h%h%h%h %h(%h0%h8p%h@`1^PTRhhQVhРU=tu8PpСp8u鸸t hxtÉUÍvU常th|hxiÍvUÐT$hD$ PR Ð& UWVSt$4D$tj:VÅu1:)PV5"ƍCP!D$ |$8tEhT$ ‰lStl9jhj ‰lSt l9tcjh@j ‰l>vSt l9t#jhjb ‰lR"Uv'RPSt l9t#jhj ‰lR![Ív UWVS1ҋl$81Eu1Et&tuth&D$@PuD$@PL$8QvD$D$=xtujU Ãunh*!8&uW=tCt l9t#jh2j ‰lR`UgÃD$L$4QU =tIL$4QUt l9t#jh`jl ‰lR L$4QÃ} &D$8uj:L$8Q:tD$8=|#|$t |$jh!jUL$DQ@ÃL$4Qt l9t#jhj ‰lRdPD$$D$,UjD$,D$4D$(PU318'#8t[hL$4Qt l9t#jhj ‰lRdPf c=tHL$4Qt l9t#jhj ‰lR=0 |$DL$DquL$4Q3L$DAtP hSÃtvvjhS u CP2u`M&'hjLÃu('L$4Q D$H|$DtL$Di jUY1a=u|$t|$u jU1|$tL$4QL$Q|$tL$9L$tUL$Q[^_] É'WVS|$\$t(SCPCPC PCPSW] Ãuԉ[^_Í&'UWVSl$1FuH t l9t#jh@jk ‰ lRjfF9t5UCPtSCPCPC PCP1 ǃ[9u([^_]É't l9t#jhj ‰lRD$PCD$PUWVS1h1jah<1hN0hN6h5atpVft[rt{ntd tvtb'Fv'xt&j`~&x&|h&X&hDhcjv'tPǃ&'jdPCjhhYL$4QL$4Q9tiuu=u =xtEt l9 t#jhoj ‰l Rjx)D$$L$( L$(t(uhǃWŃt&|$$jdPLzt&l$$kL$(PD$=~HL$Q$t l9(t#jhj ‰$l(RKjL$QTD$$|$uQ=tHL$Q,t l90t#jhj{ ‰,l0R=CD$|$uJL$Q4t l98t#jhj ‰4l8Rj L$QL$QtJL$Q<t l9@t#jh j ‰<l@Rj L$QuŃu]L$Q2ŃuJL$QDt l9Ht#jh`jG ‰DlHRjB EPL$ APvt!EPPL$ APUu9E PL$ A P=tkE PPL$ A PtJL$QLt l9Pt#jhj ‰LlPRj EPÃthdPNqSt&'SD$u1TvPjhP%Pà 'SPÃhju[Í'UWVSu] uUЋMtzt80t-@80t(@80t#@tttu@@+E$)ĉeQhMQG11E {u18nuxoƁPMQuEPMQu[uu E11e[^_]Ít&UWVSl$u1'ƹt&ƹtƹuUN$$<0u/L$$<0u!D$€ʈG L$FCG9uD$[^_]Ít&WVSt$\$jSVV]G?ƒW GG[^_Ðt&S\$t(t PCt PCS:[Í'UWVS\$jjT$ Pm u~PVD$CPIŋCP>NjC P3ƋCPCPVWUT$4RhT$DPÃ0T$RUWV؃ t&[^_]YÐt&VSt$ ~ 0~&Phh  Fj h ÃPtlFP8t l9<t#jhj ‰8l<RdPjh à F t&K r; uh Ã<#S SSS$SSwS(S SYS,SvS>ápDPt:jj jS0pDBt CDBu&0;tPSápDPtCjj jS4pDBt)vCDBu 4;tP8t &FHN~ uȃ~JHt l9Lt#jhbj} ‰HlLyPF@PFPt l9Dt#jh@j% ‰@lDRdPt&1[^ÐS1pPt[ÐWVS|$t@=Pt7P1TPWu;uѸ[^_ÍlUWV1S$h$D$D$D$L$VhU L$QUjt uu$ %=`ubD$jWÃ|R$PhLS" t#8uS+W*t&D$S FVhhƃt@\$ hS-u~VjdS uV|$uD$$u_Ptl9T~jhj ‰PlTVD$눍|$|$uNXtl9\ jh j ‰Xl\t&'|$uYh`t l9dt#jhj7 ‰`ldRht l9ltcjh@j ‰hll>t&pt l9tt#jhj ‰pltR`1[^_]lÁUWVS$$?u1S$Q(D$4|$,}B?u"8uj1ۋ$VD$4|$,}$Q&S$VD$8|$0}$Q&ƃ7L$4L$(1#j@$VD$\P Ƅ$t]UD$L}LUxtl9|jh@j: ‰xl|&$L$DD$Ht, tqbD$Lvt l9t#jh`j ‰lRj P$S Ƅ$L$$tttu@@)؉D$L t l9t#jh`j ‰lR(jP$Pe Ƅ$D$Lt l9t#jhkj ‰lR1ōvML$#QUpfPfD$D$$t$L$D$1|$#9~5t$thL$&Bt&'BЋL$ ؋t$L$1H&Rt l9tsjhj ‰lNvEGit&Pt l9t#jhjb ‰lRdP t$,VhLL$8Qd }%h&'t$(VhLL$8Q$ }%jhLt$8V h2}L$0Qt$0V=~[$Q$V$Qt l9t#jhjK ‰lR1[^_]İÐ&VSt$ jVÃ}iP贿PVt l9t#jh j ‰lRdP<&jhLS }hB`&SҾ=~DVt l9t#jhUj0 ‰lR1[^ÐUS|=|tЃ;u]ÍvUÐUS[3]addr=umount: can't get address for %s umount: got bad hostp->h_length Cannot MOUNTPROG RPCBad UMNT RPCumount: %s: invalid block deviceumount: %s: not mountedumount: %s: can't write superblockumount: %s: device is busyumount: %s: not foundumount: %s: must be superuser to umountumount: %s: block devices not permitted on fsumount: %s: %s`@@ @@@@@@@@@@@@@p/rootrootfsnfsumount2no umount2, trying umount... could not umount %s - trying %s instead umount: %s busy - remounted read-only roremountumount: could not remount %s read-only %s umounted loop,loop=umount: cannot find list of filesystems to unmounttypesread-onlyversionverboseno-mtabhelpforceallUsage: umount [-hV] umount -a [-f] [-r] [-n] [-v] [-t vfstypes] umount [-f] [-r] [-n] [-v] special | node... /usr/share/localeutil-linuxafhnrt:vVumount: %s umount: only root can do thatnoprocTrying to umount %s Could not find %s in mtab umount: %s is not mounted (according to mtab)umount: it seems %s is mounted multiple timesumount: %s is not in the fstab (and you are not root)umount: %s mount disagrees with the fstabuserusersumount: only root can unmount %s from %suser=umount: only %s can unmount %s from %s/etc/mtabignorewarning: error reading %s: %sr/proc/mountswarning: can't open %s: %smount: could not open %s - using %s instead /etc/fstabloop=UUID=LABEL=%s/etc/mtab~%dcan't create lock file %s: %s (use -n flag to override)/etc/mtab~can't link lock file %s: %s (use -n flag to override)can't open lock file %s: %s (use -n flag to override)Can't lock lock file %s: %s can't lock lock file %s: %stimed outcannot open %s (%s) - mtab not updatedw/etc/mtab.tmpmount: warning: cannot change mounted device with a remount unknownmount: warning: cannot change filesystem type with a remount error writing %s: %serror changing mode of %s: %s can't rename %s to %s: %s not enough memorybug in xstrndup call ,swap%s: Out of memory! mountno%snoneprocdevpts%s %s %s %s %d %d [mntent]: warning: no final newline at the end of %s [mntent]: line %d in %s is bad%s ; rest of file ignoredutil-linux 2.9v|DESxornoneno/dev/loop%dr/proc/devices loop mount: could not find any device /dev/loop#mount: Could not find any loop device. Maybe /dev/loop# has a wrong major number?mount: Could not find any loop device, and, according to %s, this kernel does not know about the loop device. (If so, then recompile or `insmod loop.o'.)mount: Could not find any loop device. Maybe this kernel does not know about the loop device (then recompile or `insmod loop.o'), or maybe /dev/loop# has the wrong major number?mount: could not find any free loop deviceUnsupported encryption type %s Password: Init (up to 16 hex digits): Non-hex digit '%c'. Don't know how to get key for encryption system %d ioctl: LOOP_SET_FDioctl: LOOP_SET_STATUSset_loop(%s,%s,%d): success loop: can't delete device %s: %s ioctl: LOOP_CLR_FDdel_loop(%s): success afhnvVyrst \mount-2.9v.>N^n~ΐސ.>N^n~Αޑ.>N^n~Βޒ.>N^n~Γޓ.>N^n~  ( G HXHo(ooxGCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)01.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.bss.comment.note# 1((t7 ? [Goxx To(( 0c XX l `` @u  H ~/=RR lla xxb||bbb4c``d `dggkhELFT44 (444t``` /lib/ld-linux.so.2GNU     ("3):+F"K \hą:nd$v["t4""$"ԅTH"__gmon_start__libcrypt.so.1libc.so.6textdomainprintfgetopt_longputs_nl_msg_cat_cntr__dcgettextunamefprintf__deregister_frame_infooptindsetlocalestderrerror__errno_locationexitbindtextdomain_IO_stdin_used__libc_start_main__register_frame_infoGLIBC_2.0ii \    $ (,0 48<@DHLPTXUS[Ltb]5%%h% h%$h%(h%,h %0h(%4h0%8h8p%<h@`%@hHP%DhP@%HhX0%Lh` %Phh%Thp%Xhx1^PTRhЊhQVh_U=u8PС8u鸤t hÉUÍvUTthhqÍvUÐUVSu] `hj`hhhTptw!mtdatmwvnt'mst rt$^vt'U TUv TIv T=v T1v T%v T vT? vjjh hSVC=\thhh"jv=Xt j895t j&=TuTxScuL,t 90t#jh1j ‰, 0R0j DžxunknDž|ownSjSPjEPj7;Pj) |PjxPj jvUUTt."TTt  Pu hPÍvUS]tU5`4t 98t#jh`jv ‰4 8R5 5`<t 9@t#jhj! ‰< @RDt 9Ht#jhj ‰D HRLt 9Pt#jhj ‰L PRSUS=tЃ;u]ÍvUÐUS[7]Xߋm֋n΋rƋsp\aallversionprocessorsysnamereleasenodenamemachinehelp/usr/share/localesh-utilssnrvpma1.16GNU sh-utilsuname (%s) %s cannot get system nameunknown%s%cTry `%s --help' for more information. Usage: %s [OPTION]... Print certain system information. With no OPTION, same as -s. -a, --all print all information -m, --machine print the machine (hardware) type -n, --nodename print the machine's network node hostname -r, --release print the operating system release -s, --sysname print the operating system name -p, --processor print the host processor type -v print the operating system version --help display this help and exit --version output version information and exit Report bugs to sh-utils-bugs@gnu.ai.mit.edu `Zjzʅڅ *:J  Њ(ȁ  t oToo*GCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)01.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.bss.comment.note# 1((7 ȁP?Go***ToTT c ttl ||u  ~/DDTT|Њ    P``\\\dxELFp4<_4 (444QQQ l @[@@ /lib/ld-linux.so.2GNU%'&$" !  # %  ("30@"9)@Gp"P@\Љ+hЈo^0"`]$P["M$P|" +"$.5@"; "LQp"` idxg"CH"__gmon_start__libcrypt.so.1libc.so.6textdomainioctlprintfstdoutvsprintfcfgetospeedgetopt_longgetenv__strtol_internalputs_nl_msg_cat_cntrcfgetispeed__dcgettextopterrabortcfsetispeedfprintf__deregister_frame_infocfsetospeedoptindsscanftcgetattrgetopt_long_onlystrcmpsetlocalestderrerror__errno_locationexitbindtextdomain_IO_putc_IO_stdin_used__libc_start_mainstrchrfputstcsetattr__register_frame_infoGLIBC_2.0ii < #&  % $ "  $( ,048US[wbt$]5%%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h% h%h%h%hp%h`% hP%$h@%(h0%,h %0h%4h%8h1^PTRh4h0QVhU=u8PС8uPt hÉUÍvU帠thhÍvUÐUWSE PuSF1эy, ;(}*v;(|5j ,1҅~5j ,5S=,[_ÍvUS]tU50t 9t#jhj ‰R5 0PPt 9 t#jh j ‰ Ra $t 9(t#jh`jY ‰$(R,t 90t#jh j ‰,0R4t 98t#jhj ‰48R<t 9@t#jhj ‰<@RUDt 9Ht#jhjM ‰DHRLt 9Pt#jh@j ‰LPRTt 9Xt#jhj ‰TXR\t 9`t#jhj ‰\`RIdt 9ht#jhjA ‰dhRlt 9pt#jhj ‰lpR3SUWVSM 0hjhh7hmhh hhu VMQE1Džx,/atgt!EDžxEjhdh u VMQu5tM9M <7\>-uf~au~u Mzgu\Au (u# (jpQv\Vdt,pQ`6jVDž|E rpQ`6xuP6t 9t#jhjN ‰RjjjE`tM9tF}pVjj tLt 9t#jhj ‰R0j ]1SjtLt 9t#jhjR ‰Rw0j p߹<e|up߹<t 9t#jh`j ‰Rjj t 9t#jhj ‰RD1u\]čvP\Ph \CG;vj1UWVSu]} tFu 1SvW6uu׭tuЭu} u1C% Cnu˭u,} tC% 0C@C$ C.Uu BuBu0} t$?C $׉CccvUuUBuBu CCuu S uu} t K qc gvuu4} tC$ C 5C% 0C#vuu<} tC$ C KC% 0C#߀cvUuUBu BuBtuuHU#;>4Ǻ$<uhiXE<D}u 5j =,e[^_ÍvUWVSEjMQjMAPh<5j ,ESMt(MDPNPhGmEMMuBu BuBuMAPAPhm =,t5j ,=1Dux>;Et 5j ,>EMQPu#;u 4hfvDt4hi`<o5j R,e[^_UWVSu} VtVV99u*V,PPt P:vVPPVPxPtPu ,e[^_ÍvUVS]s ss3h1vPhF~5j Ke[^U WVSu} UUREPEPEPEPhVu_EEGEGEG u1ۍUUURURhVuE;uC~ր>u 1e[^_ÉUWVS}=t-1v3W u  ;uݸe[^_UVSu=t(1;4u <u1e[^ÉUWVS=t)u1ɻ2 <u=txEUDtUR3# tUR3#!ЉEU<ue[^_ÍvUEu>t 9t jhYj‰~w  u ^ ?nv M -=v/=wE^?/v^ ^@  ÉUS]haEPjjStLS t 9$t#jhdj ‰ $RjjjpE]UVSu}uNjhhu jLt0htvt $jփuuuhj7ve[^ÐUWVSu uu4juVEPÃ?t ;Uu v}:REP4…u ȃ5w$vS$Et `S$Eb @S$EB S$E"ۍvBE1e[^_ÐUS=tЃ;u]ÍvUÐUS[s=K]deccrtLCASElcasetabsdecctlqcbreaklitoutpass8rawcookedsaneeknloddpparityevenpcrtkillechokectlechoechoctlprteraseechoprttostopxcasenoflshechonlechokcrteraseechoeechoiextenicanonisigff0ff1vt0vt1bs0bs1tab0tab1tab2tab3cr0cr1cr2cr3nl0nl1ofdelofillonlretonocronlcrocrnlolcucopostimaxbelixanyiuclctandemixoffixonicrnligncrinlcristripinpckparmrkignparbrkintignbrkcrtsctsclocalcreadcstopbhuphupclcs8cs7cs6cs5paroddparenbtimeminflushlnextweraserprntsuspstopstartswtcheol2eoleofkillerasequitintrsaveallTry `%s --help' for more information. Usage: %s [SETTING]... or: %s OPTION Print or change terminal characteristics. -a, --all print all current settings in human-readable form -g, --save print all current settings in a stty-readable form --help display this help and exit --version output version information and exit Optional - before SETTING indicates negation. An * marks non-POSIX settings. The underlying system defines which settings are available. Special characters: * dsusp CHAR CHAR will send a terminal stop signal once input flushed eof CHAR CHAR will send an end of file (terminate the input) eol CHAR CHAR will end the line * eol2 CHAR alternate CHAR for ending the line erase CHAR CHAR will erase the last character typed intr CHAR CHAR will send an interrupt signal kill CHAR CHAR will erase the current line * lnext CHAR CHAR will enter the next character quoted quit CHAR CHAR will send a quit signal * rprnt CHAR CHAR will redraw the current line start CHAR CHAR will restart the output after stopping it stop CHAR CHAR will stop the output susp CHAR CHAR will send a terminal stop signal * swtch CHAR CHAR will switch to a different shell layer * werase CHAR CHAR will erase the last word typed Special settings: N set the input and output speeds to N bauds * cols N tell the kernel that the terminal has N columns * columns N same as cols N ispeed N set the input speed to N * line N use line discipline N min N with -icanon, set N characters minimum for a completed read ospeed N set the output speed to N * rows N tell the kernel that the terminal has N rows * size print the number of rows and columns according to the kernel speed print the terminal speed time N with -icanon, set read timeout of N tenths of a second Control settings: [-]clocal disable modem control signals [-]cread allow input to be received * [-]crtscts enable RTS/CTS handshaking csN set character size to N bits, N in [5..8] [-]cstopb use two stop bits per character (one with `-') [-]hup send a hangup signal when the last process closes the tty [-]hupcl same as [-]hup [-]parenb generate parity bit in output and expect parity bit in input [-]parodd set odd parity (even with `-') Input settings: [-]brkint breaks cause an interrupt signal [-]icrnl translate carriage return to newline [-]ignbrk ignore break characters [-]igncr ignore carriage return [-]ignpar ignore characters with parity errors * [-]imaxbel beep and do not flush a full input buffer on a character [-]inlcr translate newline to carriage return [-]inpck enable input parity checking [-]istrip clear high (8th) bit of input characters * [-]iuclc translate uppercase characters to lowercase * [-]ixany let any character restart output, not only start character [-]ixoff enable sending of start/stop characters [-]ixon enable XON/XOFF flow control [-]parmrk mark parity errors (with a 255-0-character sequence) [-]tandem same as [-]ixoff Output settings: * bsN backspace delay style, N in [0..1] * crN carriage return delay style, N in [0..3] * ffN form feed delay style, N in [0..1] * nlN newline delay style, N in [0..1] * [-]ocrnl translate carriage return to newline * [-]ofdel use delete characters for fill instead of null characters * [-]ofill use fill (padding) characters instead of timing for delays * [-]olcuc translate lowercase characters to uppercase * [-]onlcr translate newline to carriage return-newline * [-]onlret newline performs a carriage return * [-]onocr do not print carriage returns in the first column [-]opost postprocess output * tabN horizontal tab delay style, N in [0..3] * tabs same as tab0 * -tabs same as tab3 * vtN vertical tab delay style, N in [0..1] Local settings: [-]crterase echo erase characters as backspace-space-backspace * crtkill kill all line by obeying the echoprt and echoe settings * -crtkill kill all line by obeying the echoctl and echok settings * [-]ctlecho echo control characters in hat notation (`^c') [-]echo echo input characters * [-]echoctl same as [-]ctlecho [-]echoe same as [-]crterase [-]echok echo a newline after a kill character * [-]echoke same as [-]crtkill [-]echonl echo newline even if not echoing other characters * [-]echoprt echo erased characters backward, between `\' and '/' [-]icanon enable erase, kill, werase, and rprnt special characters [-]iexten enable non-POSIX special characters [-]isig enable interrupt, quit, and suspend special characters [-]noflsh disable flushing after interrupt and quit special characters * [-]prterase same as [-]echoprt * [-]tostop stop background jobs that try to write to the terminal * [-]xcase with icanon, escape with `\' for uppercase characters Combination settings: * [-]LCASE same as [-]lcase cbreak same as -icanon -cbreak same as icanon cooked same as brkint ignpar istrip icrnl ixon opost isig icanon, eof and eol characters to their default values -cooked same as raw crt same as echoe echoctl echoke dec same as echoe echoctl echoke -ixany intr ^c erase 0177 kill ^u * [-]decctlq same as [-]ixany ek erase and kill characters to their default values evenp same as parenb -parodd cs7 -evenp same as -parenb cs8 * [-]lcase same as xcase iuclc olcuc litout same as -parenb -istrip -opost cs8 -litout same as parenb istrip opost cs7 nl same as -icrnl -onlcr -nl same as icrnl -inlcr -igncr onlcr -ocrnl -onlret oddp same as parenb parodd cs7 -oddp same as -parenb cs8 [-]parity same as [-]evenp pass8 same as -parenb -istrip cs8 -pass8 same as parenb istrip cs7 raw same as -ignbrk -brkint -ignpar -parmrk -inpck -istrip -inlcr -igncr -icrnl -ixon -ixoff -iuclc -ixany -imaxbel -opost -isig -icanon -xcase min 1 time 0 -raw same as cooked sane same as cread -ignbrk brkint -inlcr -igncr icrnl -ixoff -iuclc -ixany imaxbel opost -olcuc -ocrnl onlcr -onocr -onlret -ofill -ofdel nl0 cr0 tab0 bs0 vt0 ff0 isig icanon iexten echo echoe echok -echonl -noflsh -xcase -tostop -echoprt echoctl echoke, all special characters to their default values. Handle the tty line connected to standard input. Without arguments, prints baud rate, line discipline, and deviations from stty sane. In settings, CHAR is taken literally, or coded as in ^c, 0x37, 0177 or 127; special values ^- or undef used to disable special characters. Report bugs to sh-utils-bugs@gnu.ai.mit.edu/usr/share/localesh-utils1.16GNU sh-utilssttyagthe options for verbose and stty-readable output styles are mutually exclusivewhen specifying an output style, modes may not be setstandard inputinvalid argument `%s'missing argument to `%s'ispeedospeedrowscolscolumnssizelinespeedstandard input: unable to perform all requested operationsnew_mode: mode 0x%02x: 0x%02x ^-undefno size information for this devicerows %d; columns %d;%d %d COLUMNS\dltline = %d;%s = %s;min = %d; time = %d; %s-%smin = %d; time = %d;speed %lu baud;%lu ispeed %lu baud; ospeed %lu baud;%lu %lu %lx:%lx:%lx:%lx:%x%lx:%lx:%lx:%lx%n:%x%n11520057600extbexta384001920096004800240018001200600300200150134.513411075500bBinvalid integer argument `%s'hvversionhelp+%s (%s) %s OA?A@ARRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRtRRRRRRRRRRRRRRRRRЬha]0Y0U 0Q00KG @@:3+$  @ޮ خҮʮ Į @|wrmi e a@@]@YUPIB=7. ( !@   ݭ ׭ Э ˭ ȭ ŭ         į     ~x toίaɯgWT2QKMnIC?;7,3X. ) $ `   %K K@vƈֈ&6FVfvƉ։&6FVf 0 4(Є`  00oooGCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)01.0101.0101.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.bss.comment.note# 1((87 ``p?ЄGoNTo c l (u 00 ~00/``pp "44-``-h$ QZZZZ@@[[L[]^^ELF@44 (444̪̪\ /lib/ld-linux.so.2GNU     pA"!",)30;+G"L,] "dp"w@"}$@["00@""( ""`\P"Ї@"H"2І:"8"__gmon_start__libc.so.6stpcpytextdomainprintfmemmovegetopt_longputs_nl_msg_cat_cntrmalloc__dcgettextcallocwritefprintf__deregister_frame_infooptindreadreallocsetlocalestderrerror__errno_locationexit__fxstatbindtextdomain_IO_stdin_used__libc_start_mainopen__register_frame_infoclosefreeGLIBC_2.0ii =(,0 $ (, 048< @DHLPTX\`dhl pt x|US[Û$ptry]5%% h%$h%(h%,h%0h %4h(%8h0%<h8p%@h@`%DhHP%HhP@%LhX0%Ph` %Thh%Xhp%\hx%`h%dh%hh%lh%ph%th%xh%|hp%h`1^PTRhXhpQVhU=Ԫu8PЪСЪ8u@t hԪÉUÍvU帰th4hÍvUÐUS]tU5Lt ,9Pt#jhj ‰L,PR5( 5Tt ,9Xt#jhǕjy ‰T,XR.\t ,9`t#jhj6 ‰\,`Rdt ,9ht#jhj ‰d,hR%PUv<8~-0J9sH @19sHÐUVS]u cvPS57 }Llt ,9pt#jh1j7 ‰l,pR<0jS VS5+ }(5h. 0j# v\e[^ÐU WVS MMMAMu+E;E}vMQW5T }Ltt ,9xt#jh1jT ‰t,xRY0jp });]}SWMQfuރ M9M+uVMQ5 }L|t ,9t#jh1j ‰|,R0j uM QMQ5 }'5h.0juM FMMȉE EE}~.},t}0} t}$tJ5Vƃ}(t$F FMAM 9}|} t5VPƃ}v^F@FMAMvD~vu ^F?ސMF-FvwÀĐ^F?뼍v^F뮍v u }t 띀 uEvMAM u}u ^FIF ẗF։e[^_UWVSEEEEEEDž|DžxDžtM h@jhAhShS5We5E8A Tbt: tnt\stkuvtEEvtEDž|tEtEtDžxDž|ftDž|TtDž|EDžx/tEtDžx jjh@h]] SMQ=thhhmh{j=t j]pSjj }Lt ,9t#jhjp ‰,Ru0j E؅tEEE%=uMM]]E 0M]9}vM] 8-uxuEvjPpQ5j }5h.0E؅t l Džl}Mȉ9Eu{9Uuv]9]un=u =t\5t ,9t#jhj ‰,Rjjtu/El9}ȉlPpƋlSV `l@POƋl]D P:NjMQ]SMQ]SxQ|SMQWlSVt0W_VVuBt85}&5h. 0j"EM9M}t$j}h0j j}Lt ,9t#jh1ji ‰,Rn0j =%P=UWVS} uEt.VWURà }8tމ])эvEe[^_ÐUWVS} u 8uVWURà |؍e[^_US1ۃ}u jÃuHt ,9t#jhj[ ‰,Rj5x؋]ÐUS]ScSz]ÐUS]u S uSW]ÉUSE] u SSP}uS$]ÐUS=tЃ;u]ÍvUÐUS[ó]Try `%s --help' for more information. Usage: %s [OPTION] [FILE]... Concatenate FILE(s), or standard input, to standard output. -A, --show-all equivalent to -vET -b, --number-nonblank number nonblank output lines -e equivalent to -vE -E, --show-ends display $ at end of each line -n, --number number all output lines -s, --squeeze-blank never more than one single blank line -t equivalent to -vT -T, --show-tabs display TAB characters as ^I -u (ignored) -v, --show-nonprinting use ^ and M- notation, except for LFD and TAB --help display this help and exit --version output version information and exit With no FILE, or when FILE is -, read standard input. Report bugs to textutils-bugs@gnu.ai.mit.edu%swrite error0b)ns vETAversionhelpshow-allshow-tabsshow-endsshow-nonprintingsqueeze-blanknumbernumber-nonblank/usr/share/localetextutilsbenstuvAET1.22GNU textutilscat (%s) %s standard output-%s: input file is output fileMemory exhausted 0 ݪƆֆ&6FVfvƇև&6 p X( =  ohoo(GCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)01.0101.0101.0101.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.bss.comment.note# 1((7 ?GGo((>Tohh c l u  ~pp/@@ XXI ̪4  t(((;ELF4`4 (444//000,| /lib/ld-linux.so.2GNU     ("3,):`AL+MT̆"Yhj\v\}"<|$܆["l\3"d""l"|  "&lH"__gmon_start__libcrypt.so.1libc.so.6textdomainprintfstdoutgetopt_longgetenvputs_nl_msg_cat_cntr__dcgettextopterrfflushstrrchrfprintf__deregister_frame_infooptindferrorsetlocalestderrerror__errno_locationexitbindtextdomain_IO_putc_IO_stdin_used__libc_start_mainfputs__register_frame_infoGLIBC_2.0ii <\ `dhl\`d hl ptx|  US[+`tbJ]5T%X%\h%`h%dh%hh%lh %ph(%th0%xh8p%|h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h1^PTRhhQVh?U=8u8P4С48u܆t h<8ÉUÍvUlthph<1ÍvUÐUS]tU5t h9t#jhj ‰hR5d 5t h9t#jh@j ‰hR>t h9t#jhjF ‰hRt h9t#jh j ‰hRXSvUWVS} EhMjhNh`7h`]hiu!hHhyh~hWMQEM}8-uopxtPhtMC;utAvSЉFFwp$ȐqiEnv U M E = 5Ê<w*\F<w\F5`j\;5`S,FEM}~I5`j 5`PlM}~5`j ѐ}t5`j 5`5`uh0j j`UVSu\\}uNjhh!u j t0htvt $jփuuuh#jv\le[^ÐUS@=@tЃ;u]ÍvUÐUS[Ç]Try `%s --help' for more information. Usage: %s [OPTION]... [STRING]... Echo the STRING(s) to standard output. -n do not output the trailing newline -e (unused) -E disable interpolation of some sequences in STRINGs --help display this help and exit (should be alone) --version output version information and exit (should be alone) Without -E, the following sequences are recognized and interpolated: \NNN the character whose ASCII code is NNN (octal) \\ backslash \a alert (BEL) \b backspace \c suppress trailing newline \f form feed \n new line \r carriage return \t horizontal tab \v vertical tab Report bugs to sh-utils-bugs@gnu.ai.mit.edu/usr/share/localesh-utilsPOSIXLY_CORRECT1.16GNU sh-utilsechoneEerror writing to the standard output444444444444444444444444444444444444D4444̊Ԋ܊44444444444444hvversionhelp+%s (%s) %s Lbr†҆"2BRbr  ( < PtD0o$ooGCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314 (egcs-1.1.2 release)01.0101.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.bss.comment.note# 1((7 ?FGo8To$$ c DDl LL(u tt ~/LL`  O 00 <<@@HHPPd\\P\ELF464 (444111,4,, /lib/ld-linux.so.2GNU    4;;=Ȅ7 ؄ >VgO.(=PJd8=H=X6p'h=FxA= __gmon_start__libc.so.6ioctlgetenvfchownlseekrenamewritereadtcgetattrerror__errno_location__fxstat_IO_stdin_used_exit__libc_start_mainopentcsetattrcloseGLIBC_2.0ii (      $US[h?Hts{v-[5%%h%h%h%h%h %h(%h0%h8p% h@`%hHP%hP@%hX0%h` % hh%$hp1^PTRhhlQVh_S=t Ѓ;u[ÉÐXUWVS1D$dD$`D$@D$\D$XD$TD$P8*vHB&D$pD$pD$\hwL$HD$Lt$H|$Lu Iv|$XuDB Ȇ!Ԇe ,tD$\tv@D$d(D$D\L0P*)vH|$D|$DD$D)D$`|^|$Xt1T$DD$D3t$D|$XuD$DT$@BT$@I*D$`^K D$`^Q |$Dt$`4t$`(v=LLtJ|$@;|$\D$@A@L@LdD$@D$\9D$@~ދT$@LL t$`3);|$`d$D|$D D$D8D$`|$XvD$\|$Dt!D$DD$DT$\t$D  t t|$\;D$DXvT$DBT$Dt+3t$\|$Xu/@L|$@ G|$@tD$\T$@D$\BT$@Mu0܉RZz" 0FDT"hx-0D$dL$@D$@9l$d}It$@ t> tD$dL$dD$dD$H}D$HT$Ht$d))L$d9~|$D)|$@T$DT$@3搃=JD$LƒJ3P=|$Xu|$P9|$@}OD$D|$@A~6 @LL$@vD$@x tHD$@D$X vD$XT$@: tBT$@D$XD$X|$@A~(L$@듍v|$Xu݋t$@>/v~/w܋v,S|$Xu+D$@Hsv|$Xu͋|$@?/v߀/wًvxJ =v6Vv=LHDLD$@LH< |$XT$@ !|$X5(t$DD&=$|$D\D$\tALH|$XuND$@"!|$Xt%T$@DL3t$\LL;|$@D$PD$@ԉD$@AȉPHT$@뺋 LHot$@t$D=|$@|$@uD$DD$@t$@t$D=HLփx tD$@A1vD$D)D$@ԎNs3vT$D)T$@(<t$@> X& |$XD$D|$Xu<|$\|$@HL)D$D-HL-v58T$@HL |$XWvv |$Xt$@5|$D=HLX^|$XuT$@9~D$Xt$X3=|$@v\$DD$XT$@qHLt$D)T$@|$@=8v|$X뼉l$@-HL0D$XHyT$Xu I =I tND$\<*d$D|$DYukv|$Xu,ܑF|$Xx,J4t$@5DHH =|$`9|$D|)|$DD$D@4tL T$@T$\-LD$T3D$TD$@`HD$dD$`t$\95DHuC=u:|$T |$`=LD$`4t|$XtvT$P9T$\ t I Lvt$P9t$\uD$\9|$\?|$DD$\ u-L$d}L$LD$d)Ⱥ)‰D$D |$D th|$D~|$DuD$D.t$`95^D$d|$d9=4D$DT$@BT$@1ɃvD$`v+5+t$`t6=Ju|$@ G|$@1Ƀ8AD$@ @D$@Mu+T$@`M+5DHt$@J +|$\;t2=Jt D$XkvJID$\'=Ju;JD$\T$\t$@D$\Ft$@MuD$X;|$\+v+T$\<cv|$Xt=tD$\끃=ta+t$\3v|$XB뽍v=8t t9L$\| |$\9=HLD$XD$XTD$dD$dD$DuD$DPT$DJT$Lt$L5L|$D=-`H1T$D+t$d3|$`;D$PT$\t$@3= |$DD$`|$@D$dD$\`HD$\D$DD$\D$d|$@}T$@9tD$DT$@D$`D$@|$DuL$d|$`t$d3=L)|$d(D$d+D$DH`H\+D$Dp^LT$dL3t$@;|$\D$PT$`3t$d+;|$Du`T$Dt$d3|$`;l$DD$dD$`T$d+3t$DHPLD$dhD$d+|$@;LT$`9T$d|T$dD$`l$@t$`3|$d; 5LLD$`T$`LT3t$d;|$`|$Du D$`j|$D tb|$Du&|$`nL$`L$@D$`ƀjH Vv|$DHT$Dt$@Ft$@|$`jHG|$`D$d9T$@35L;|$@+D$`D$Dt$X;@HPHT$@@H|$DuD$D|$D$D$` |$D1B|$D77|$DHW|$DwLD$` |$DA9|$Dx.D$`|$D5|$DI|$DyD$`|$DD|$DtD$`|$DC|$DvD$`|$D4|$D8|$DF|$DqD$`|$DB|$Drt{D$`|$D6tA|$DGte|$Dst^D$`|$D2t$|$DLtH|$DptAD$`|$Dlt2|$D3u3t$`3'v;|$`|$D~8D$Dě ED$D␃+t$`3D$`|$@ tH? u O|$@D$`D$@L$@< tMucyt$`)։t$D;|$`+[vD$DD$@ސ+D$@D$@< tMuﺞ)T$D+L$@D$Xt$P9t$@|vD$X|$@@}D$XLL=L|$dEMLD$dL)‰w @L&v@LZv-L@L@)@L0v|$Xu D$@MuL$@D$@-L@LH@Ltv|$Xu D$@MuL$@t$D)t$@;vD$\D$X=8t HLA| =A|9}D$XD$XT$@: uD$X=JuD$Xvt$@31;|$@<T$\D$dt$@+t$DNt$\D$\|$@9|$\}@D$\8 tD$d㐋L$dT$dT$D}T$Dt$D|$d))L$d볐D$d0D$DT$\3v|$@;D$@D$\T$@3|$@|$\D$\D$\ t vx/wT$\+T$@T$D3vD$DD$`=LO|$DD$`LD$dT$D9t|$`u D$dND$dDD$d0LHD$dL D$d v5Lt$d|$d=LD$D+T$dt$`3|$\;D$@[vID$d 0T$@3t$\;|$`D$d+T$D3vD$dII[I0I0I0I;I0I0I0IHD$@I|$d|$DD$dvT$dD$@It$DD$D D$D0T$dD$dT$@JT$@|$DuЋ|$D-HHA+l$P9l$D~;ipJBD$Xt$@3|$P|$\N)ʼnT$DT$@D$\T$@L$\JT$@Mu3t$@I*|$D|$P HL9} HL 9L$@} L$D D$XD$@D$DD$`T$d9T$@9| t$@5=HL|$d9|$@9|$`| D$@HL|$DT$@T$DT$\t$P)։ED$\T$@D$\BT$@Mu\$DvĢ|$Xu~t$@9595HLj=HL+|$\|$D9|$XuFD$\T$@|$Dtl$DD$\T$@D$\BT$@Mu3t$@D$X`z|$\t1D$@|$\?|$DD$\D$DT$@BT$@uD$` D$@AD$PA|$D|t$Dt$`v D$\* M|$XD$`0 vD$@AD$PA|$D|$D|$`d v|$DIL%LT5X50=HH|$dl$@/ |$D$DD$dؤ v|$DT$dAT$Pt$P D$XD$X=I tD$\30=/tmpt_D$`D$\D$DtD$\T$DD$\BT$DuL$Dt$D~F A=L|$dy v|$DD$DD$`0T$d- vAD$PD$d)l$d |$DT$d9T$D~H |$Del|$XAD$`ID$d |$Dl$\5HLt$d|$D|$`?ԦZ|$XD$`I? v|$Dv|$DD$D8T$d|$XuPl$@\|$D|=l$Dxv|$D|9t9l$du(D$Xt$dt$D|$@;D$@J* L$D v+D$@=tJSD$@D$\J J:D$@JPT$\t$@D$\Ft$@MuD$\J;|$@l|bD$D+T$dt$`3|$P;D$\T$@Ȩv-IaHD$`INS =JtD$`OVR D$`dH|$`T$`eH|$`D$`fH|$`T$`gHD$@jHD$\t$\6t$DD$\tD$DT$@BT$@Muۋ5QHt$@=G|$DlD$@:HD$@@LT$DHĩ3t$@;|$\D$PT$`3t$d+;|$DD$X T$D+t$d3|$`;D$PT$\t$@3D$@`H:|$DBT$\t*|$D t"D$DT$@BT$@t$\6t$DD$\u׃;|$@D$\T$P3t$`+;|$D+D$@D$@`H-MvT$@ BT$@Mu3t$@+;球D$D+T$dt$`3|$\;D$@D$\FI|vT$X-3t$X;|$@D$\T$`3t$d+;|$D@ I DLLHHL,@HA@L8JHH@JERROJR L0D$`|$D|0T$DT$`D$d̬|$Dt$Dt$`D$d|$D|*D$d|$D;(D$DD$\Z@KT|$XT$D(D$\d%D$\P@K|$Xu d$LvD$`D$dPUT$hRD$P3t$X d$L1|$dWUD$hPD$PT$X d$Lt$`VbD$H;|$Pd$Lh<D$dPj{D$P Ut$dVD$L;|$Td$LD$dPUT$hRD$P3t$X d$L|$dWUj[D$PD$X d$LvT$dRjt$hVD$P;|$X d$Lvj%h\Lj8L\L%L%LLLD$LLD$DPjj\T$X d$LS=t Ѓ;u[ÉÐUS[[TERMlinux "   !   & '  ( #$ NAME: SAVE:SAVE? Y/NBLK NAME:^QF FIND:^QA REPL:^QA WITH:^QI LINE:OPT? C/B/etc/e3.res/etc/e3.hlpH܏,؎ʐ̏h4p̉X$WxȌh0X ̑7hXWDl܈ԇ4,$̉,΄ބ.>N^n~ l ( xõooGCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.95.2 19991024 (release)GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.95.2 19991024 (release)01.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.plt.init.plt.text.fini.rodata.data.ctors.dtors.got.dynamic.bss.comment.note# 1((7 0?Go&Tõ c l x ull,{(,1ܱ11333L,,444L~5x5ELF4@24 (4447+7+8+88l, /lib/ld-linux.so.2GNU%0&#),-  "(/ +* %.$ !' ؋!!؊",)3:+FPWb _H"duX:"|Xȋ"\;$؉Ah"3"7" 8;"H4")#$+2(<C"I\Q8"bx;"ghl"{*Ȋ(l"ȉt"x"__gmon_start__libc.so.6strcpytextdomainprintfstdoutgetopt_long__ctype_bgetenvdirnameputs_nl_msg_cat_cntrmallocoptarg__dcgettextreaddir__lxstatrenamestrrchrfprintf__stpcpy__deregister_frame_infooptindstdinferrorstrncmpstrncpyunlink_IO_getcsymlinkopendirstrcmpsprintffclosesetlocalestderrerror__xstat__errno_locationlinkexitbindtextdomainrpmatch_IO_stdin_used__libc_start_mainclosedir__register_frame_infofreeGLIBC_2.1GLIBC_2.0ii ii #  lpt*x.|"&  '%),Ļ!Ȼ̻л-Իػܻ(/ $US[1tv]5d%h%lh%ph%th%xh%|h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h%Ļh%Ȼhp%̻h`%лhP%Իh@%ػh0%ܻh %h%h%h%h%h%h%h%h 1^PTRhphXQVhU=@u8P<С<8uht hL"@ÉUÍvUȉthhLQÍvUÐUWVS} MQWÃtuGؼt 9ܼt#jhj ‰ؼܼRjj EPVj tVh"0jPPSjW tSh0j\V#S1ҋP9Eu:T9Eu/\9Eu$WAPMQ4PKЉЍD[^_ÉUWVSu DžL=EPMQjƒ tEPh82Xv=uWE%=@uHMQt 9t#jh j ‰RjPHPVj'à tt VhR`%=@t<=D`%=V5}1҃)ԉEPSS4S ‰1Ӊэ\)܉RVS~f/BRmދHPVj)à tt VhR==t 88tMQEPjƒ P9Eu}T9Eur\9Eug}tVMQcƒtNVEPt 9t#jh`j ‰Rjj5tHQVjƒ `%=@uFVt 9t#jhj ‰Rjtv=tcV5t 9t#jhj3 ‰R5A ub1v=uOuSVt 9t#jhj ‰RjRVÃuGt 9 t#jhja ‰ Rjj 1҃)ԉLSLPS+LQV>ƒ 8tGVt9jh¢j ‰vDžLtVNtgb8t]Vt9bjhբjS ‰:t VhR)=tNEPV5 t 9$t#jhj ‰ $R\VMQЉƒMQV5(t 9,t#jhj ‰(,RE0jLt`VLPƒtJV0t 94t#jhj ‰04R0j@4[^_US]tU58t 9<t#jh@j ‰8<R5) PP@t 9Dt#jhjT ‰@DR Ht 9Lt#jhj ‰HLRPt 9Tt#jh@j ‰PTRCXt 9\t#jh`j ‰X\R`SrUhWVS1E hjhhphhÃtHh1dt_1SFtEVbt*ntcft,it?stWvt^|r\DD6*H j jhh˩M QEPƒ=t"hةhܩh2j=t jM9 uN`t 9dt#jhjQ ‰`dRjjjKtSB =tI8ht 9ltljh j ‰hlGvxpt 9tt#jhj ‰pt]K9uh$E 4E9M ME t1Ҁ|/EPMQjXƒ E%=@}1҃)ԉEPSCSS$‰1Ӊэ\)܉RVSf/BRSEPǃME tVƒuGxt 9|t#jh@j ‰x|RjjC 9}+VM 44׃E@UB9|׃=t%PUWVSu1эQHуsʉUЃPSǃtbVW} tIW)f8.WPDƒ} utE8BRhS> VWtj~SWe[^_ÉU WVSu Et}E}1эq::t3Z 1эQF9rVSEPAƒ ;U~UEPƒuEP!…uE1e[^_ÉUWVS} u1VWuu4<>.u.|7~u'L7 \BABЃ v9~uyt1ۉ؍e[^_ÉUS]t;u0hS}PSh^jvЪ]UUЀ:tv8/uP@8uÐUS]5tFt 9t#jhj. ‰RjS` 5tHt 9t#jhj ‰R0S]ÉUj6UWVSuj/V?u 8/uH9w)xGPdÃu1vWVS|؍e[^_ÐUXS1ۍEPujUuE%=@؉؋]ÐUWS]1эQ~ 9/u IJe[_ÐUVS1ۍu# t1C}vuDP u3C5ƒu3V%x[^ÐUWVSu uÉ1эQуL wVP9wEDe[^_ÐUWVSU EE}1IM1:tPӉEPEP3ƒ u+;1IE9t*}uu vEF;u}u E e[^_ÍvU}u  u u5P5ÐUSP=PtЃ;u]ÍvUÐUS[]b֡FǡnfiSsvVversionhelpversion-controlverbosesymbolicsuffixinteractiveforceno-dereferencedirectorybackupvirtual memory exhausted%s%s: hard link not allowed for directory/`%s' and `%s' are the same file%s: cannot overwrite directory%s: replace `%s'? %s: File existscannot backup `%s'cannot remove `%s'create %s %s to %s cannot create %s `%s' to `%s'cannot un-backup `%s'Try `%s --help' for more information. Usage: %s [OPTION]... TARGET [LINK_NAME] or: %s [OPTION]... TARGET... DIRECTORY Create a link to the specified TARGET with optional LINK_NAME. If there is more than one TARGET, the last argument must be a directory; create links in DIRECTORY to each TARGET. Create hard links by default, symbolic links with --symbolic. When creating hard links, each TARGET must exist. -b, --backup make a backup of each existing destination file -d, -F, --directory hard link directories (super-user only) -f, --force remove existing destination files -n, --no-dereference treat destination that is a symlink to a directory as if it were a normal file -i, --interactive prompt whether to remove destinations -s, --symbolic make symbolic links instead of hard links -S, --suffix=SUFFIX override the usual backup suffix -v, --verbose print name of each file before linking -V, --version-control=WORD override the usual version control --help display this help and exit --version output version information and exit The backup suffix is ~, unless set with SIMPLE_BACKUP_SUFFIX. The version control may be set with VERSION_CONTROL, values are: t, numbered make numbered backups nil, existing numbered if numbered backups exist, simple otherwise never, simple always make simple backups Report bugs to ./usr/share/localefileutilsSIMPLE_BACKUP_SUFFIXVERSION_CONTROLbdfinsvFS:V:4.0GNU fileutilsln (%s) %s missing file argumentsymbolic linkhard link.when making multiple links, last argument must be a directory~..~%d~Ǫnumberedtexistingnilsimpleneverversion control typewrite error.%s: invalid %s `%s' %s: ambiguous %s `%s' \Ήމ.>N^n~Ίފ.>N^n~΋ދ X p(  `(0@ooo`GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: LM(GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)01.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.bss.comment.note# 1((\7 ?Go```To0c l 8u 00( ~XX / ` pp  88+LL+PP+XX+``+,,,70,c1ELF44 (444   |  /lib/ld-linux.so.2GNU    |"%),$3+?<"D,Ua h $pL"03"/(܆","̆\"Dlt"__gmon_start__libc.so.6textdomainprintfstdoutgetopt_longputs_nl_msg_cat_cntr__dcgettextopterrfprintf__deregister_frame_infooptindferrorsyncfclosesetlocalestderrerror__errno_locationexitbindtextdomain_IO_stdin_used__libc_start_main__register_frame_infoGLIBC_2.1GLIBC_2.0ii ii |  $(,0 8 <@ DHLP TX\`dhlptxUS[wPt6z]50%4%8h%<h%@h%Dh%Hh %Lh(%Ph0%Th8p%Xh@`%\hHP%`hP@%dhX0%hh` %lhh%php%thx%xh1^PTRhhQVhԈOU=u8PС8uLt hÉUÍvUth4hqÍvUÐUS]tU5Lt ,9Pt#jh`j ‰L,PR5( 5Tt ,9Xt#jhj ‰T,XRN\t ,9`t#jhjV ‰\,`R dt ,9ht#jh@j ‰d,hRx{SUVSu] hij*hjh|[h|qhhhhSV*,tGlt ,9pt#jhji ‰l,pRjjj rjKUS]5$VtFtt ,9xt#jhj ‰t,xRjS 5$tH|t ,9t#jhj ‰|,R0S]ÉUj6UVSu  }uRjhhu j(t4htvt (jփuuuhj 0e[^ÐUS=tЃ;u]ÍvUÐUS[]Try `%s --help' for more information. Usage: %s [OPTION] Force changed blocks to disk, update the super block. --help display this help and exit --version output version information and exit Report bugs to ./usr/share/localefileutils4.0GNU fileutilssyncignoring all argumentswrite errorhvversionhelp+%s (%s) %s ("2BRbr†҆  (h؁  ,$0oĄooGCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)01.0101.0101.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.bss.comment.note# 1((7 ؁?hh)Go2ToĄ0c l (u $$ ~/܅   @@      $$ ,, T   h ELF4l#4 (4444 /lib/ld-linux.so.2GNU!     ("%8),3X+?bQ"Vgȇ:"nuhX$;؇"įh7"(3"xH"\" x"-?8gFHt"\"__gmon_start__libc.so.6textdomainprintfstdoutgetopt_long__strtol_internalputs_nl_msg_cat_cntrmallocoptarg__dcgettextfprintfmkfifo__deregister_frame_infooptindumaskferror__assert_fail__xmknodfclosesetlocalestderrerror__xstat__errno_locationexitbindtextdomain_IO_stdin_used__libc_start_mainstrchr__register_frame_infofreeGLIBC_2.1GLIBC_2.0ii aii k į ĮȮ̮Ю Ԯ خܮ   US[ï'ptx2]5%%h%h%h%h%h %h(%Įh0%Ȯh8p%̮h@`%ЮhHP%ԮhP@%خhX0%ܮh` %hh%hp%hx%h%h%h%h%h%h%h%hp% h`1^PTRhthQVh?U=u8PС8u؇t hÉUÍvUHthȯhÍvUÐUS]tU5xt 9t#jh j ‰R5 5xt 9t#jh`j ‰R>t 9t#jhjF ‰Rt 9t#jh`j ‰R(SUWVSuM xhjhh7h]1ۃ tmu  vjejhhM QVPuă=dt#hhh Zj?v=`t jjfׁjS`Ãu?t 9tgjhʚj ‰BvuGt 9 t#jhךj ‰ Rjj SPrǃį)Ѓ@t9jhj ‰~~?t 9tbjhj ‰=v t 9$t#jhj ‰ $PjjjKįM D./usr/share/localefileutilsm:4.0GNU fileutilsmknod (%s) %s invalid modevirtual memory exhaustedtoo few argumentstoo many argumentswrong number of argumentswhen creating block special files, major and minor device numbers must be specifiedinvalid major device number `%s'invalid minor device number `%s'%swhen creating character special files, major and minor device numbers must be specifiedmajor and minor device numbers may not be specified for fifo fileswrite errorxȓXh|xstrtolxstrtol.c0 <= strtol_base && strtol_base <= 36ؖ,.>N^n~·އ.>N^n~  t( a  0ooo~GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)01.0101.0101.0101.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.bss.comment.note# 1((7 ?uGo~~BTo0c l (u    ~/tt  t%%!"ELFX4HD4 (444>>>H ? /lib/ld-linux.so.2GNU%( " #' ! $ %& "%ȉ),D38;9+EPO؉@V%\"aLrTy8؈$("Xx3x3"%hA)HH"H\"\#X"2$A(%HZga@qt"Ȉ7"__gmon_start__libc.so.6textdomainprintfstdoututimegetopt_long__ctype_bmemcpycreatputs_nl_msg_cat_cntroptarg__dcgettextabortfprintf__deregister_frame_infooptindmktimeferrorstrncmplocaltimetimestrcmpfclosesetlocalestderrerror__xstat__errno_locationexit__fxstatbindtextdomain_IO_stdin_usedgmtime__libc_start_mainstrchr__ctype_tolower__register_frame_infocloseGLIBC_2.1GLIBC_2.0ii ii @%DHL PT X$ &$(,'048 <@ DHLP TX\`d#hlptx| "US[Ftwof"]5%%h%h% h%$h%(h %,h(%0h0%4h8p%8h@`%<hHP%@hP@%DhX0%Hh` %Lhh%Php%Thx%Xh%\h%`h%dh%hh%lh%ph%thp%xh`%|hP%h@%h0%h %h1^PTRhh8QVh/U=u8PС8u(t hrÉUÍvU帘th\hÍvUÐUdWVS}MMQWj9 Ƌt Wh<P=hWÃuWh<6=tSUWh<6MQSj tWh<6jSvS} Wh<6z=tjNv=t8E@UBUBEuEEuEBRWu1Wh<0je[^_ÍvUS]tU5t L9t#jh@jn ‰LR5H 5t L9t#jhj ‰LR5t L9t#jhj ‰LRut L9t#jhj ‰LR2t L9t#jh`jJ ‰LR?S1UWVS1EM hjhh9hvf%atXctOdtVrmvt=(v j5T5TtL9jhj ‰Lv Tvj 5T=uM5Tt L9t#jhj9 ‰LRjjZFh5T Ã(}QS5Tt L9t#jhʰj ‰LRoj  jjh@hM QMQa=\t hذhܰhjL=Xt j=u t=u=u=t\=tSt L9t#jhj ‰LRjjjt6h5j t5h<i0jFuyX;E}AM Tu BuBt!jM 4tXFu(uhBX;Euvt L9t#jh2j ‰LRjjjX!M 4aEXH X;E|ڃ}%PXUWVSpDP@Dž<1DžHnLDžLLf:DD9L@4D)LLLC<'~h <='~ Dž<'<҉Ѓ$)ĉD4]VQDR< )ĉ@S4R@PDtL@tD 9L0 u Dž%vwL Dž 3w{ ];ueJ}_==t HTHI0*k],IJ~)8K/$<x|lptyFvFFFF|ۉ(Q+)()ˋ( F죈FFF죈FF|}Nۉ$Q+)$)ˋ$ NQ+)Ӊ) ى vĉFģd dFhmFdhXFvvN~ F] FVFأډFVأFFFOvFFF#v_vFKv;vF'vvFvvFvvFvvFvv xt=lt=tu \>'lQ+)У+)ʉ)Ӊh + A xc NQ)ˉQ.+ )УDž88))L8,^KM6L׃3w&}Lff9u J{)u}119sЃ A9r1ɍUU9s-U܍{EԍTPЋE܉A9rۋ]؋U t$ЃPFPS \ I  N A N wu N ;wd NE tPVS uB}u@EUӃЃ wEHQЃ w LAЃ=v  v 1e[^_Uu u$u h{ÐUu ut 1UWVSU EE}1IM1:tPӉEPEP3)ƒ u+;1IE9t*}uu vEF;u}u E e[^_ÍvU}uǾu u5P5HÐUS]5DjtFt L9t#jh޾j ‰LRjS 5DtHt L9t#jh޾jv ‰LR[0S]ÉUj6US=tЃ;u]ÍvUÐUS[ $o]cܫd׫rͫrȫX\versionhelpreferencefiledateno-createtime modifymtimeuseaccessatime%sTry `%s --help' for more information. Usage: %s [OPTION]... FILE... or : %s [-acm] MMDDhhmm[YY] FILE... (obsolescent) Update the access and modification times of each FILE to the current time. -a change only the access time -c do not create any files -d, --date=STRING parse STRING and use it instead of current time -f (ignored) -m change only the modification time -r, --reference=FILE use this file's times instead of current time -t STAMP use [[CC]YY]MMDDhhmm[.ss] instead of current time --time=WORD access -a, atime -a, mtime -m, modify -m, use -a --help display this help and exit --version output version information and exit STAMP may be used without -t if none of -drt, nor --, are used. Note that the three time-date formats recognized for the klmnopq-d and -t options and for the obsolescent argument are all different. Report bugs to ./usr/share/localefileutilsacd:fmr:t:invalid date format `%s'time selector4.0GNU fileutilstouch (%s) %s cannot specify times from more than one source--file arguments missing &),#/0 %(+".$' *!-12 1 6 2<3:-. *+ ,!"#$%&/'0()31248597=;      8parser stack overflowparse error@ȕ ԗ@`t@,,@PPdtt,8˷ ·               x  qjb]SLC>81(saturdayfridaythursthurthursdaywedneswednesdaytuestuesdaymondaysundaydecembernovemberoctoberseptseptemberaugustjulyjunemayaprilmarchfebruaryjanuary |wsng c \ X secsecondminminutehourdayweekfortnightmonthyear  `  ݹع ӹ͹ǹ    agotwelftheleventhtenthnintheighthseventhsixthfifthfourththirdfirstnextthislastnowtodayyesterdaytomorrow0-)%!<x, ,hhXX޼XټXּѼͼɼļL\\ {ws0n0i0d0idlenzdtnzstnztgsteadteastjstcctwadtwastzp6zp5zp4bteetfstfwtsstswtmeszmestmewtmetcetidlwntahstcathdthstydtystpdtpstmdtmstcdtcstedtestadtastatwatbstwetutcutgmt<x,hXL~|zx\v trpln0lzyxwvutsrqponmlkihgfedcbaama.m.pmp.m.dst%s: invalid %s `%s' %s: ambiguous %s `%s' write error~Έވ.>N^n~Ήމ.>N 8 (d   H@o؆ooGCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)01.0101.0101.0101.0101.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.bss.comment.note# 1((<7 dd?GoPTo؆0c l 8u HH ~88/hhXX *  + > >>?  ??@@@ @@bbBjCELFЉ4)4 (444###P# /lib/ld-linux.so.2GNU%%#!" $   !!", )3X:@+F"K`\:"cdjpv"~p;"\0$ A"h@7"3"j"`4"0P\"\`"Ј"+:LPl"Ut"k"__gmon_start__libc.so.6strcpytextdomainprintfstdoutgetopt_longputs_nl_msg_cat_cntrmallocoptarg__dcgettextreaddirabortchmod__lxstatfprintf__stpcpy__deregister_frame_infooptindumaskferrorreallocopendirfclosesetlocalestderrerror__xstat__errno_locationexitbindtextdomain_IO_stdin_used__libc_start_mainclosedir__register_frame_infofreeGLIBC_2.1GLIBC_2.0ii pii zX\`d h@D#HLPTX\`d hl ptx|!" $ US[k+t"x_]58%<%@h%Dh%Hh%Lh%Ph %Th(%Xh0%\h8p%`h@`%dhHP%hhP@%lhX0%ph` %thh%xhp%|hx%h%h%h%h%h%h%h%hp%h`%hP%h@%h0%h 1^PTRhhQVhU=u8P С 8u鸠t h rÉUÍvUthlh ÍvUÐU VS]u EPP EtUrt`9jhj ‰`t `9tijh jc ‰`Dt `9t-jh`j' ‰`KvEP%PuRe[^U`WVS}EUURWj: u2E%=uL}u 1vURWj t)=uWhm0jU Ru E%9tbVWCÃt uu%PVW t@=uWh0j&E=u jVW =t E%=@uURU RW EEe[^_ÍvUWVS]Ets,EP Euqt$=uMQhRjvt `9t#jhj ‰`Rjj( }1щMAMQ EEPMQEMD/u>tf1ҋE;]v ]MQEPq EVMMQjE PMQp U +]ހ>uEPaMQXEe[^_ÐUS]tU5t `9t#jhj ‰`R5\ PPPt `9t#jhj ‰`R4t `9t#jhj\ ‰`Rt `9t#jhj ‰`RSUWVS} E1hjhhhOhujhhWMQC=$\tK9tGĴt `9ȴt#jhj' ‰Ĵ`ȴRjj8 fdUE5%jy=t#h&h*h8/~jv=t j4u=u 5hhM9 h|N̴t `9дt#jhGj ‰̴`дRjj%jtP vj4Åu=Դt `9شtejhj ‰Դ`ش@uKܴt `9t#jhjZ ‰ܴ`Rjjk #u5h0jFh;E}44pjSh4 EhH h;E|̓=tMQUS]5X:tFt `9t#jh`j~ ‰`RjS 5XtHt `9t#jh`j& ‰`R0S3]ÉUj6UU Etr-} BwvB-@tBxB-ÉUE Utxxt@S@stxxt @Sv@stx xt @ Tv@ tÉUE%=`u bhv= u cW=@u dG=u -7=u p'=u l=t ?sÐUWVSu ]WgFP%PFP%PFPSVWe[^_UEu @PÐUSMt#1 v\A<vu]ÉUWVSuVǃ|I&j Eu UB=BfzfBEjEPEN1EF./usr/share/localefileutilsRcfvrwxXstugoa,+-=invalid mode4.0GNU fileutilschmod (%s) %s too few arguments؏ĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐĐtwrite errorTTTTTTTTTTTTTT,TTTTTTT<TT̖ TܖMemory exhausted0&6FVfvƈֈ&6FVfvƉ  (X p 4؆0oxoo,GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)GCC: (GNU) egcs-2.91.66 19990314/Linux (egcs-1.1.2 release)01.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.bss.comment.note# 1((07 XXP?Go,,JToxx0c l (u ؆ ~/Љ ( #  #$$#,,#44##XX$X$4'$(ELFԥ4 4 (444666dLdttt /lib/ld-linux.so.2GNU]|Dw^UYC67Tt9$J "[Bz@(LOgQ)v!#._IcW3/e*2,` Z}m GXi NFEy1bP?%VxprR0-{;=H+u'q&8KAds 5lnfah>4jk S\~oM:< -t6L RX4 ` q QP ,U4 m4 m4 $* 0*)-=y, K [xsXhp* X* d* P*8* D* n5 #lC :@C" TC" kC"  ! !h !\ !P !D !L)t !7T)=\)Cd)Il)Ot)U|)[)a)g)m)s)z)))))* * * |* * * +* E* ^ĥ!e4="kd)rHy4:":"Ta)   ="TTb" @t4rt/"%3"*D:"1D."8DĠJ"O?"U\\ġ"f$:"mI"tb~ t"Pdm"$:"T2a) "Ԡ="D!D$;"T) b -:8`? RXX#"]d3"dd"k="pxԣZ"Dj"ԤJ"\Ģ)TRt|"T)$:"Ĥ"ģ'b# :H"T$\cT6jLq$F"w"~Ԣ""y<Āt6$g4`"ap ԡC@(`t >7"D X"]DgD!pw$~$*__gmon_start__libutil.so.1libncurses.so.5_DYNAMIC_GLOBAL_OFFSET_TABLE__init_finitgetent__terminate_func__cplus_type_matcher__vt_9exception__vt_13bad_exception_._13bad_exception__vt_8bad_cast_._8bad_cast__vt_10bad_typeid_._10bad_typeid__ti13bad_exception__ti9exception__new_handler__vt_9bad_alloc_._9bad_alloc__vt_9type_info__vt_16__user_type_info__vt_17__class_type_info__vt_14__si_type_info__ti17__class_type_info__ti16__user_type_info__ti14__si_type_info__ti9type_info__ti10bad_typeid__ti8bad_cast__tf9type_info__tf16__user_type_info__tf19__pointer_type_info__tf16__attr_type_info__tf16__func_type_info__vt_19__pointer_type_info__vt_16__attr_type_info__vt_16__func_type_info__vt_16__ptmf_type_info__vt_16__ptmd_type_info__vt_17__array_type_info__tiv__vt_19__builtin_type_info__tix__til__tii__tis__tib__tic__tiw__tir__tid__tif__tiUi__tiUl__tiUx__tiUs__tiUc__tiSc__ti17__array_type_info__ti16__ptmd_type_info__ti16__ptmf_type_info__ti16__func_type_info__ti19__builtin_type_info__ti16__attr_type_info__ti19__pointer_type_info__ti9bad_alloclibc.so.6strcpyioctlprintfstdoutcfgetospeedrecvconnect__register_framepthread_createpthread_getspecific__write__ctype_bgetenv__strtol_internalfgetspthread_key_deletememcpyexeclperrorgetuidfeofmallocisattycfgetispeedsiglongjmpsleepoptargvsnprintfsocketselect__frame_state_forfflush__ctype_toupperstrncasecmpsendabort__sigsetjmp__register_frame_tablestrrchrrindexwriteenvironfprintfkillstrcatpthread_once__deregister_frame_infosetsockoptoptindpthread_key_createstdinwaitferrorsignalreadstrncmpstrncpystrcasecmpreallocstrtokstrdupinet_atongetoptmemsetinet_ntoatcgetattr__assert_failherrorstrcmpshutdownpthread_mutex_unlockgetpwuidgethostbynamegetpwnam__deregister_framegetservbynamegethostnamesprintffcloseatexitstderrvforkfwritepthread_mutex_lock__errno_locationexitfopen_IO_putcfileno_IO_stdin_used_exit__libc_start_mainstrchrsetuid__register_frame_info_tabletcsetattr__ctype_tolower__register_frame_infoclosepthread_setspecificfree__environ_environ_etext_edata__bss_start_endGLIBC_2.1GLIBC_2.0Tii ii `?pCP;hA (1+&85@7D8$0%  \>T<"#) /44lB'.<6L: X= H9$-,2 (,!d@ *03|@HGLPdDTOXv\^`t x$U(,M0X48\<l@NDHLPTVXn\P`ydchl[patx_|bHYgqrhsuR]Q{~pFWTj} fEZ e$(J,k0|48<@oDIHLP`TX\`dhzlpwtxDUS[olt]5%%h% h%$h%(h%,h %0h(%4h0%8h8p%<h@`%@hHP%DhP@%HhX0%Lh` %Phh%Thp%Xhx%\h%`h%dh%hh%lh%ph%th%xhp%|h`%hP%h@%h0%h %h%h%h%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h%h%hp%h`%hP%h@%h0% h %h%h%h%h% h%$h%(h%,h %0h(%4h0%8h8p%<h@`%@hHP%DhP@%HhX0%Lh` %Phh%Thp%Xhx%\h%`h%dh%hh%lh%ph%th%xhp1^PTRhhQVh/U=u8PС8ubt hxÉUÍvU`thdhx}ÍvUÐUWVSE`@@=@!Sh@`Ed@A1TDB tC DB u}}@]vt 9u<1A\u C t;)"u"$'u'ѡTDP u}G}C u}t C T}e[^_ÍvUU<^uBuhojhSgƃ uWSh5L;GuWSh5L".=8tjVMѸvh!1e[^_US = t!CtP3h ;u1]ÉUPU5h<)ÍvU=Xth h`ÍvUEd|]ÐUWVS}uY=tvSV;uh=Vf>uEU9U}y} v7jh7葁Ãu 7hΚuu7ht12t St VEU9U|kpe[^_ÉU4VS]u ~FфP~ eфPh  ~F#vh_5Xj2]SM؃tp=@upPPhv 5He[^ÐU=lƒlh^=lt vPh85H=ÉUSfEPEPjjjEPEPjÃ=8tuE9EuE9EtLdkj|f]ÉUSfft t{vh^shrÃuj/Su@}~jhAhPSV jPSG h!j3vjY]ÍvU=8t2jh<)蔇h'8% }u jh ÐU=8t jvh@1ÉUjvj;}ÐU=8tjj33(vhJ1ÉUS=t7Ct&8tP3h h;uˋ]ÉUjhu}UVSu] h 5L1su sh`ush5Ld1\Q B9tB1uф҄PRF9A } ҞфPh5L1s sAиe[^ÐUS=85h&}ctVh@t`fPhit`fPhzwGA=tu hvhb=Lt hLt`Ph,t1t`fPhvh)pP&Phv5H]ÉUjU8WVS] EEEEEEjjEPa =8t!5h9U`P}t@S@fWfChY5X1E)M̋EP1с?Q_@E`E؃MhÃ3yu}ֿ_uMt`ENֿbuMSv}uREM6}uUԃM#vEPh%RG}F}tЋEЊ@t !j:EP‰uj@EP‰EEPEPEPƒ uuvPKu#EPhalR$vUfE]SEPoƒt&fEEPhrEPWEtYf@fEEx ~@ E@E̋Ep E0Sj@E0h?EP{RN}"EԀ8-u@ED Dujj jEPƒvsCCVjBvSrʉ苎vߊv3CCVj迊vS2ʉKvfUfuGhȠEPE܃tf@fEEPh̠nyR1fEffEW}uEhȠhWE܃u!h5L(PLEf@fEDuPh% 5uuEPEP5h<)ƒt8=8t5EPt=t_EuXh3_EEtEPÃt/[9Ct%QPÃt E vEEtEPh3zh3J{ jjh u EPUjh<)m~jh@t1e[^_ÍvU 1Uj@ÍvUj@ÍvU@ÐUWVSj譡EdCCC Uz99} 9|5P1E1Ƀ9},A;|t PF]9~9}B9|=]uj贠EjFFF Uz99} 9|P9E1Ƀ59},A;|t PNu59~9}B9|=u]4j輟EqCCC ,Uz99} 9|5PAE1Ƀ9},A;|t PV]܉9~9}B9|=]ujĞE؃yF`FF ,Uԍz99} 9|PIE1Ƀ59},A;|t P^uЉ59~9}B9|=u؋]ԉ4j̝Ẽ~CpCC Uȍz99} 9|5PQE1Ƀ9},A;|t Pf]ĉ9~9}B9|=]̋uȉjԜEHFFF Uz99} 9|PYE1Ƀ59},A;|t Pnu59~9}B9|=u]4jܛECCC LUz99} 9|5PaE1Ƀ9},A;|t Pv]9~9}B9|=]ujEF@FF Uz99} 9|PiE1Ƀ59},A;|t P~u59~9}B9|=u]4jECCC Uz99} 9|5PqE1Ƀ9},A;|t P膚]9~9}B9|=]ujEFFF Uz99} 9|PyE1Ƀ59},A;|t P莙u59~9}B9|=u]4jECCC |Uz99} 9|5P聙|1Ƀ9}-A;|t P蒘|9~9}B9|=]ujxFFF tz99}9|Pyp1Ƀ59}-A;|t P芗p59~9}B9|=xt4jlšCCC @hz99} 9|5Pmd1Ƀ9}-A;|t P~d9~9}B9|=lhj`ǡF FF \ډG99}9|5P]X1Ƀ9}-A;|t PnX9~9}B9|=`\jғT!FFF Pz99} 9|PQL1Ƀ59}-A;|t PbL59~9}B9|=TP4jƒHC CC Dz99} 9|5PE@1Ƀ9}-A;|t PV@9~9}B9|=HDj躑<IF`FF 8ډG99}9|5P541Ƀ9}-A;|t PF49~9}B9|=<8j誐02FFF 0,z99} 9|P)(1Ƀ59}-A;|t P:(59~9}B9|=0,4j螏$CCC 5 G99}9|P1Ƀ59}-A;|tP*59~9}B9|=$ 4[^_ÉUWVShÃE Pƒt.hE P~ƒthڃE Pgƒu E1EP9U}z|9|hjLhhEE P3 ƒt`} 1IQE P3xƒ u }u9]FE@E9|}u%}uE Ph Ee[^_ÐUWVSu} ]3VuSWVuhuh#hhh hvQօ|B9th 5LduC*3h[5LD3hH5L21bCPGPq @uSW*vuA 'u sA ussA 1t v1e[^_ÉUWVS}] uFuX5Hj [vrvvCCUjxrvSwʉvvjjgjj^A=@R`=`P5@h =qu5 h5t\@~vCB< tN1ہ@t7J: u1@t)=q]h@hF=qt5 h55Xhh@ 5X5XCtu=8ujh ~jDe[^_ÐUWVS}} ueh@1ۃO9v|9|hjLhh4FtP6jhxOC9|v;] }lu6WDuhn>u 6hu 6hv@tPh>h.C;] |1e[^_UXWVSU1ۉ1IM} IM=REEP-uTh‰tRh vhhnḥREDEE)E+u@#tҡTDP u1ۅ@@TDP EPEPWƒ u EPEPCEPE PWƒ u VE@PjhΣW uThhGW @ t t u,f`=`tR5@h EPhh@ƒ EP?e[^_ÍvUWVS} k}aM tMJUvM 9Eu>!uFG>@GGFEEMMG;E}:u1@C8Mt1},uC;@uC}@tҀ}:tC Muր}u1ۋMQVTuAVgt(P ~ @ @R0MQ M 11NvEt=M *B<~G+9M9EM Me[^_ÐUt Pt PtPކUÐUl> IÍvUhhhh5 h=5Lwj U WVSu] ?Dj/3 t@v 1jhQ5  u~1qȃ@$lpq 5 h5\q5 hNv=\O5\D=q~4v5 hv5 h@5L ShVSVk =u=q `)ƍEE~E EtEhEE8EEE~ESEEjh {t j UURE)Pu1+v!jh 8jjj) e[^_Uj5h@h@t jcv5jh h`ut j:HUh@w}7^<5Gjh<) ^ \jh貼%UWVS]u }VcCs CCCC;USe[^_UWVS}1ۅhjKhh uvG9}EU CVURދU ؍e[^_ÐUSM1ۃy~?Q;QuAvAE AQA 9|)‰QI؋]ÍvUS]KIyK SE KC]ÍvUWVSE8uhjyhh¦AUZ}hjzhhʦu1=\t \EH PU x)ؙ֋EX9t.hhhh贻UZJ BEz&vu9}΋UJ9~)u~9~hhhhY9u(EEUR}E@EUREPI&UU EP}URUEPURI щà E9xu@ًUJJr 9|)JEP)ډUPH @E4Uz);uthhhh腺~;]|[E4)9tNhhhhE\3\"v\C\e[^_ÐUVS]EPu hVPVS [^UWVSu}FN )9~h 5L&F~ )19})VM  NFVF 9|)‰VFC9|׍e[^_ÍvUVSu^NIyN 9}N 9u19F)Q^SPB Љ|FFV 9|)ЉFNuȍe[^ÐUÐUÐUW_7 1  }UU9u>21v9u=t2ې2Ӑ9uth3뷐9u @3뤉9u 0됉<u/9u S0p9u 0YvÐUEHwp$c[SKC;3+# 1U5jh@U=Lt05jh vÉU=Lt=t&11ÐU=8t2ÐUhjmhjahpj UhjI j4jh<)wYh<)XÍvUWVS] Eh<)cYE5E5EtEU }t]u4 }tEU}tEU}tEUEM9};E}E}t1Rhh h@Pw},u Ƶ8u 1Phj藶䐋}MM<t<`j2<3t)<3h`|Hu E EUmM3t93h)\} vu E vEM ]ut i E t  ` 4P1~MEe[^_ÐUPPChjh舶dH@8`pqrÐUVS]} t+ 3u uju^  3EjEPh@p EjEPh@Y ]jEPh@C Shh 8e[^ÐUVS]} t+ 3u tjt^$ 3EjEPh@ EjEPh@ ]jEPh@ Shh 7e[^ÐUVS]} t+ 3u uju^  3EjEPh@@ EjEPh@) ]jEPh@ Shh \7e[^ÐUVS]} t. 3u 4ujt^$ 3EjEPh@ EjEPh@ ]jEPh@x Shh 6e[^ÉUWVS]t!Ɉ <t3t<uq3ud"w8$($=4t 4$;.v1t ;jS j. jS 3e[^_ÐUVS]t!Ɉ <t3u<u3trtt@t9=t/=4t 4%G t jSj#. u=4t 4%$3e[^ÉUWVS];t%ʈ;<t3t;<;3'wb$vjS%hbNt37jju jS d1tjSsj(-B;jS3v"u+jj Djj 3e[^_UWVS] ׄt&ʈ t34t < u93t-"u  €3t jSHjb,$3e[^_ÉUWVS}u 19W|9|h`jLhh蹭4ίu1vCF9|e[^_ÍvUxWVSEP19~m}vU}WxEpV3sE1Ƀ}}9}ËEvA;M|ut R]rE}uV19~}EBxuFj:}W蠫EthEP*}1I( 1ɋu>tv| uB:u}Wy0EPWsƒ uVUZN9~}9}vM}O9|EpVqEE}}9}}Ev21E}9}|Et Rq}u>V9~9}EB9|u^>uE4hj覮E}W9|9|h`jLhhFEEu6u}7E P@E| uvu9|h`jLhh}?}EE0u|;]|h`jLhh贪}9}|h`jLhh蓪EuE};G|h`jLhheu6}>EP96v۴9󸿩᳢uV<}EE4uu1|9|h`jLhhǩvE9Eru|9|h`jLhh蔩}E 1u|9|h`jLhhh|9|h`jLhhJ}9|E;X|h`jLhh!u6uE}uVCB9} } 1I'uN9~m}vMEH|u~WnE1ɃFE9}]A;M|ut RmE}W9~}}?B|E@} 1<U܍BEuN9~n9}M}O;M|EpVmE1Ƀ}}9}ËEA;M|ut RlE؋}W9U~;U}u6B;U|E}G7}éEPUԍZ|9|h`jLhh?uV}?]ЍBEuN9~p9}vM}O;M|EpVlE1Ƀ}}9}ËEA;M|ut RlE̋}W9U~;U}u6B;U|E}G7EЋ}ԉuvuȉFu}O9~g9}MEH;M|u~W lE1ɃFE9}]ċA;M|utRQkEċ}W9U~;U}u6B;U|E}G7}|[^_ÉUS]uh (u#t1t]U tPjUS=,u5, ($h<£=tYh˩RDÃtEPjS1 t  éh Sh B0 $09u 010|9|h`jLhh~ ]ÍvUS)É؃Phj!Sh (h@]ÉUWVS1,'(s:0'4'}t 8 t  (rщe[^_ÍvUWVS11U:} ujDcv;] }VUt t! vt WU|Ct UFCtW먍vje[^_ÐU塤(thP5(vh((u-h#(((Gv(((((('(((ÉUD(t@ÐUWVS]=(t;uBj]SO5jWU5Ã`SjW75ÃuAS5Ɖ1эQt0ы=(LT U(9Uwv=(D:(9vy(()WR蜗‰(u-h@裗((( (()‰)У( (7ʅ|'~u( ((((Cut((1e[^_US (()Z}u~A(((R(Pj>S5(h@*(t$P8(((]ÐUVS1{]Sh`yN$E1 u>u5=lu,=` =4EEjEE=uv _RSh`Eu)=`=4E jE2u/ u*=`[=4NE jEPh`=`u =4uE jEPh(t =l=`=4E jE=`u =4uE jEPh( =l=`=4xE jE(v=`]=4PEEjEPh( 2U$vhhhb`jh<)4`qv=`W=4JEjEPh(Rhhb uhhbuuhhbuuhhbufEu  !HLj%}uhhb:u*jIv}u.E E==tws(sEBuhhg\O MEs&sB( ()ȃne[^ÐU= u1' jhjÍvUWVSDžlX=L)lj|h}dhWh)fDžl|˃=q=t)q9 =  .t 9ujhj9ujhj}p9u =pq9tRh)q| t p9=p1hWh)9t5|ȃp9tQh)iuChdWh)PWj=<r91hWh)z~,|ȃr9tQh)u;=hǃ=hjg <tSQv|9 td t%ssz<tƅ{ j{Ph@ ƅz jSe=Xu/ƅy jyPh@e ƅxjx-ƅw jwPh@6 ƅv jvPh@ ƅujuPh@ ƅtjtb|sjRPvu0ƅrjrPh@ ƅqjq|pjpPh@a X=L)lj~lX[^_ÐUWVS1=Xt2=u$u=tu t5() ))1Ƀ=ux9lȃ=`Ѓ}%PVSRWQÃ=)t Ã=xt É؍e[^_ÍvUX=Dtjjjjjjjj jj!jj"jj'jjP h(t jj#ct Pj juUÍvUEjEPh@ EjEPh@ EjEPh@h 4jjhh  ÍvUEjEPh@ EjEPh@ hhh H =t+ÐUEjEPh@ EjEPh@ hhh  ÉUEjEPh@r EjEPh@[ hhh  ÉU}EjEPh@! P\EjEPh@ hhh E ÉUStDEEEEEEE]jPj>djSh@$h1]ÍvUEjEPh@^ EjEPh@G hhh   =te=\tÐUEjEPh@ EjEPh@ hhh   =t=\tSÐUEjEPh@v EjEPh@_ hhh   =t}=\tÐUEjEPh@ EjEPh@ hhh 0  =t =\tkÐUEjEPh@ EjEPh@w hhh  ÉUEjEPh@B EjEPh@+ hhh p ÉUWVS4EPEPuEE}EEˆEMuEMEA' SVh@_e[^_ÍvUS]t jjt jj]ÐUS]t jjt jj ]ÐUj5|h@h(t jӄv5jh h)t j誄US1ۃ}tX((h(t(]U1҃=@t tvu=Httt=t)u/=ht#9~t  ÐUS]htP]ÉUjUh(!j 5H莀 )5X~$)ÍvU$)ÉU )ÉUWVS}u W8uVW5 )à |}3it u1ۉ؍e[^_ÍvUWVS}u 8uVW5$)qà |؍e[^_ÉU=qt su=LtÍvU@WVSu5<M9 ;` 4Pv;]S5$)ՃSj5$)"` 4Pwى5]ĉ߾MtMM=XtMee=XteMueMMueLMLMtMeeEEMuEMtMeMteM}u EOMteߋMtE% 0Èe ÚU̡%0 ‰ÙME}tDh(!jP~qupM8t7U8t0uE'u#Evjj~߾Sj5$)_~ }Sj5$)J~ ]Sh!T5$)蓀Sh!T5 )肀e[^_ÉUShj~h}uغ у= t 9B}:uEʃ= t9Z}:uE ]ÍvUS]ShT5X|P}1UESE ]UWS] 1=(u) )ƒjjSj )@P|:vj )ƒjjSj )@P|=(uɍx[_ÍvUÉUjh T5H{P UWVhj7(e^_ÍvUWV(e^_ÍvU((ÍvU((ÐUÐUE8t7vTDPt=w PЈA9uUWVS]t;Ht Ph}tJ޿Mt7hOSc~tSh\1ShQ5LzHbfe[^_ÐUWVS} uEt|URURht5nz ~ 9sPh5@zC 9rE ;HuhhPz}5/ze[^_ÍvUSMU ]=Tu6w4@QhSQh5yt4t$ttcPQh5Ey'w4h)vuh5y1vSh5x SRQh5x;Hu hhPx]UWVS1EEEEvU:'wP6h'wUPU2h UPShӮZz Ut+'w 6h{wU2hivSh^'w 6hPwU2h=vSh2Ut2'w 6h wU2h  vSh.yU:'w P6h<%wUPU2h< UPShSvy Ut+'w 6hj{wU2hjivShx^'w 6hPwU2h=vSh2Ut2'w 6hwU2h vShxEGEEECe[^_UPWVS1=Tu#}-=$ M 9 } }Ph5pr F;u|hѰ5Pr} hnM A=t2=t!|=t vh۰hhh5q} h*} GuLh5q;uvM Ph 5xq F;u|Ph5Wq ;u} >Ph5,q F;u|{h"5 qMM9T} }] M Mv}?w4`h&vMPh5p Ѓtt;tt-h*h5hAhK5Xp t Tv^P@t _^P} hv^Phm5ptPht5o }Ph{5o ?uM |1u G}CEFEE;u;u} >Ph5|o F;u|h5\o} hM Qt h^Pt ^Pt ^Pt ^Pt ^PhEPr}tE$Ph5n} G tPh5n ;uM Phɱ5`n F;u|Ph5?n ;u} >Ph5n F;u|ch׬5mM Atjyuh5mvPh5m ;u} >Ph5m F;u| $y $;Hu hѱhױPIm;uM "$زvF} <>'w>4RhܱM PRh5l;Hhh5lF;u}.v} ;Ph5i F;u|߃}t ;HuhhP}ie[^_ÐUjFv=xuH5Hqi5Lfij V!ÍvUS]SkUWVSu] 5L1IQjVlSkU WVS]u Mu ]MMMM=T v9Uur}tlC MMFMMUDWt =w @ЉEUUDWt=w @v9Et}t1v}t +EvE)؍e[^_ÍvUWVS}E u151*1PWt|܅u܉]ue[^_ÐUWVS1ۋ,)9E|9|hjQh=hEg,)}()0t`MQ|9|hjQh=hEgVfu.|;,)|hjQh=hE`g=()E C,)9T1e[^_ÉUWVSEPÃ7,)E‰F 0)9~a9}A0)9|0)@P,á,)@P5()Sh()t R+(),)9~99}R()@@ A9|Nu9}E<v()t R+St Rt+ EE;,)|ȉ5,)}|9u|hjQh=hEeE@()t R+St R+}1Q+‹EPRi‰} 1Qi+‹E PRi‰SECe[^_ÉUVS1D8t>vj=4dÃtjCPD4= FD<uōe[^ÉUWVShSƃ&Fjh[v3f tjh]vf j:vf1ѿ)WSzfj.S>cƒuSofƒtW2S=g PPet Rp)Vt R`)S1Q)hSRg‰1Q)SRg‰V[^_ULhc#hhtjphcF hpat@Uju uÉUSu4Ãt)t Pw(CtPg(C]ÐUut@Uut@UVSu4tVhVÃuVh5L,b3jAe[^ÉUWVS1ۡ,)9E|9|hjQh=hE>b,)u5()>|9|hjQh=hEb,)v|9|hjQh=hEa,)W|9|hjQh=hEa~t* PhDc,)E C9#e[^_ÍvUEÉUWVSu} v; ,)| ,)9|hjQh=hEaI()tG|9|hjQh=hE`zuu|9|"hjQh=hE`j1e[^_Uuu1@ÍvUS()t%t P%Ct P%S#]U()0),)ÐUjEPuu uaÍvUEÉUVSu] 6Z_tVT#e[^ÐUE~u jjP} h:_ÍvUS]} t j3 `3^]ÍvUWVS}]jjjbM'aPbM} h8vt"uSjjP`} h%^E } E t2jE PjjM1_};_8\t h@\^} t$jjjM1} h2^jMQM1oa txGxto^ƋMq^Ph5L]j]GW ~ G GR0EP_M1Qqh]1e[^_ÍvUEjj j0u hɴS]ÐUWVS} v^8uF 1E|uƒhVjjM@Pf]Ãt}hԴ\}vM | u1vp[^_UEuuu 0~_UUE Ph!T2v_UEÉU4)8)jh<)ÍvUh<)8)44) ÐUS[']vUS[pЋ]ÐUS[÷u u[t1E]UÍvUWVS[Áj\ƃu1N Ne[^_ÐUVS[>u4tjP_V^e[^ÉUS[Ћ]ÍvUS[Ѓ]US[45PRQ\u 76]ÍvUS[Ã06tPR[vut69u6ҋ]ÉUS[0u }0]ÉUVS[4dYƃuFV4H^te[^ÍvUS[ãЃ]UPWVS[{Љƃ@xxFG7BbN>t HPjRуu⋵~t 9u QibbvULWVS[cЉrBxxFB9BbN7t HPjRуu⋽ [^_ÍvUE@UE@UWV} EU :t`փU>}U9w0}?}9v$tIU ;|w};<rMv|U9w E E>ut I} D1e^_ÍvU WVS[þ} txE MU ztfƉ׃UM MU9w5M9v.UUtMtU RMQURЃ tEE>u1e[^_ÍvUVS["MU uD\<uB!<utjVB4#Wve[^ÐUVS[uU|\uB E  Vve[^ÐU WVS[ÆMu U|1\uO|\uH:}TU>}T0Aw PEPEEPW _Vve[^_UWVS[} uuUƃu1&vFX|8\t jWPFe[^_ÐUWVS[ãЉM xuVt v A0,tP;B+vV~u0,t PB?e[^_US[Gu?P6A]ÐUWVS[MQlt#M쉍hQlQl`u1xd1EfEҋE|lA)r9`s,vjhQdQ`Q`9r׋l`E8zu"tPQC`t`lplAp9`s;pM9pw(WhQdQ`Qb`9r͋} dE T[^_ÉU WVuvu)ĉe19s`vуtHuE@R)‰Ѕ}+u Fu4u Fuu uu G;}r11;MsutAG;}ruNe^_ÐUVS[EtxP>˫ځǪcF2vځÛVځÃ릉ځòWe[ÐUճځðuj<vu\xEEjƃx3vxE@PV'V;tv[ßxE롐[Ç#FFEEPjvv[OV [7낉[' ve[^ÐUVS[EtxPuU MFFFNe[^ÐUS[8u#xP]ÐUS[÷u u]US[×ME QAȋ]ÍvUS[c8u#P]ÐUS[u u9]US[UxE tR]US[ˢUxЋ]ÉUS[ß8u#TPP]ÐUS[[UxE tRA]US['UxЋ]ÉUS[8u#P]ÐUS[÷u u4]ÉUEÉUS[ÇMU Aȋ]US[_:uPRdЋ]ÐUS['UE 022]ÐUWVS[}u VWBt EvEt=VVPjrR…tBjjMQjWVF0Vjpƅg_WG8Wjp7~@Et1WGRjGptp x1}tS؋]UWVS} ]u1njjWh<))ƃu%it u1~=1Wrong number of arguments for command. Try %s ? for help `%s' requires a subcommand. %-*s %s %s No help available !^?offaoSend Telnet Abort outputaytSend Telnet 'Are You There'brkSend Telnet BreakbreakecSend Telnet Erase CharacterelSend Telnet Erase LineescapeSend current escape charactergaSend Telnet 'Go Ahead' sequenceipSend Telnet Interrupt ProcessintpinterruptintrnopSend Telnet 'No operation'eorSend Telnet 'End of Record'abortSend Telnet 'Abort Process'suspSend Telnet 'Suspend Process'eofSend Telnet End of File CharactersynchPerform Telnet 'Synch operation'getstatusSend request for STATUS?Display send optionshelpdodontwillwontneed at least one argument for 'send' command 'send ?' for help Unknown send argument '%s' 'send ?' for help. Ambiguous send argument '%s' 'send ?' for help. sNeed %d argument%s to 'send %s' command. 'send %s ?' for help. ?Need to be connected first. There is not enough room in the buffer TO the network to process your request. Nothing will be done. ('send synch' will throw away most data in the network buffer, if this might help.) Telnet 'send' error - argument disappeared! SENTUsage: send %s